Clone IP09419 Report

Search the DGRC for IP09419

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:19
Vector:pOT2
Associated Gene/TranscriptCG11529-RA
Protein status:IP09419.pep: gold
Preliminary Size:864
Sequenced Size:1267

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11529 2008-04-29 Release 5.5 accounting
CG11529 2008-08-15 Release 5.9 accounting
CG11529 2008-12-18 5.12 accounting

Clone Sequence Records

IP09419.complete Sequence

1267 bp (1267 high quality bases) assembled on 2006-09-13

GenBank Submission: BT029076

> IP09419.complete
AGCGCGCAGAACTCAGAGAAACGCAAAAAAAAGTTATAAAAAAAAAGCGA
AAAGACTTAACTTCAAGATTCGCAAAACGAGACTGATTCAGTGACAAGTG
CAGTACAGAAAATAAAATGATCCACAAGAGCATAGCCCACCTGCTGGGAC
TGGCAGTGATCATGTTAATGATGTGGAAGCCCACACCCACGGATAGCTAC
GCCGTGGGACAATCGAAGTACGGCAGGATCGAGAAGTTCCCCTACCAGGT
GATGCTCATCGGCAAGCAGCTATGGCGCAAACGGATTCTGTGCGGCGGCA
CACTGCTGGACAAACGTTGGATCCTAACAGCTGGACACTGCACCATGGGC
GTGACCCACTACGATGTGTATCTGGGCACCAAGAGCGTGGAGGATACGGA
GGTGTCCGGCGGTCTGGTGCTCCGCTCCAACAAGTTCATCGTGCACGAAC
GTTTCAATCCGGAGACGGCGGCCAATGATATTGCGCTGGTCAAGCTGCCG
CAGGATGTGGCATTCACACCGCGAATTCAGCCCGCCTCGCTGCCAAGCAG
ATATCGACATGACCAGTTCGCGGGCATGAGCGTGGTGGCCAGCGGATGGG
GCGCCATGGTGGAGATGACCAACTCGGACTCGATGCAGTACACCGAGCTG
AAGGTGATCTCAAATGCGGAGTGCGCCCAGGAGTACGATGTGGTCACGTC
GGGAGTGATCTGTGCCAAGGGCCTGAAGGATGAGACAGTGTGCACTGGTG
ACTCTGGCGGTCCACTCGTTCTCAAGGACACTCAAATAGTGGTGGGCATA
ACCAGTTTCGGGCCAGCCGATGGTTGTGAGACCAATATTCCCGGAGGCTT
CACCCGCGTCACACACTATCTGGACTGGATCGAGAGCAAGATTGGTAGCC
ATGGCCAAGTACATCAGCAGTACCTGCGACCACAGCAGCAACATCACCAC
CATCAGTACAGTGATAACAATCTCATTTAGGATGCCTCATTTTGCGGATG
GAATCATCCCAACAAACCACTGACTGAAACTTTATAGCTTTATGTTTTTT
AAAGGAATTCTCCAATCTTGTGATATCGTAGCTCTCATTGAAATCTGCAC
ATTGTTTATAGCGTTAACTATTTAAAAACATCTATATTTATTTTAGTTGT
AAGCGTGATAGCGGACTCGCAAACAAAAAGAAAGCAACAAATGTTGCAAA
ATCTAAAGAAATTGAATATGAAAAAATAAAAAAAAAAAACAAAAAAAAAA
AAAAAAAAAAAAAAAAA

IP09419.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-RA 1220 CG11529-RA 1..1220 1..1220 6100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12188522..12189761 1..1240 6110 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-RA 864 CG11529-PA 1..864 117..980 4320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-RA 1240 CG11529-RA 1..1240 1..1240 6185 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-PA 287 CG11529-PA 1..287 117..977 1530 100 Plus
CG10472-PA 290 CG10472-PA 57..284 234..896 428 41.6 Plus
Jon65Aiv-PA 271 CG6467-PA 46..270 228..896 425 40.8 Plus
CG10477-PB 272 CG10477-PB 27..269 186..896 422 40.6 Plus
CG10477-PA 272 CG10477-PA 27..269 186..896 422 40.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12197791..12199035 1..1245 6210 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12190891..12192135 1..1245 6210 99.9 Plus
Blast to na_te.dros performed 2014-11-27 13:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1511..1573 905..969 140 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2787..2837 912..961 135 76.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2574..2665 865..949 128 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6825 875..958 127 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6804..6876 885..958 124 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6729..6804 885..958 123 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..6793 906..970 121 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6846 906..969 117 67.2 Plus
roo 9092 roo DM_ROO 9092bp 1100..1161 906..969 117 67.2 Plus
roo 9092 roo DM_ROO 9092bp 1132..1176 926..970 117 73.3 Plus
roo 9092 roo DM_ROO 9092bp 1100..1159 912..976 115 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2350 912..958 111 74.5 Plus

IP09419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:03:27 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12188522..12189741 1..1220 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:38 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:27:05 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:10 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:49:02 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:27 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:57:17 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:27:04 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..1220 1..1220 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:10 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..1220 1..1220 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:49:02 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..864 117..980 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:27 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
CG11529-RA 1..1220 1..1220 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:03:27 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12197791..12199010 1..1220 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:10 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12190891..12192110 1..1220 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:46 Download gff for IP09419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12190891..12192110 1..1220 100   Plus

IP09419.pep Sequence

Translation from 116 to 979

> IP09419.pep
MIHKSIAHLLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQVMLIGK
QLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGL
VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQ
FAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICA
KGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTH
YLDWIESKIGSHGQVHQQYLRPQQQHHHHQYSDNNLI*

IP09419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24812-PA 278 GF24812-PA 1..278 1..287 1262 82.4 Plus
Dana\GF10666-PA 268 GF10666-PA 39..267 34..260 477 41.8 Plus
Dana\GF23751-PA 292 GF23751-PA 58..282 39..256 425 41.3 Plus
Dana\GF10671-PA 452 GF10671-PA 147..400 41..274 399 36.2 Plus
Dana\GF10540-PA 276 GF10540-PA 28..262 30..255 386 35.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15569-PA 285 GG15569-PA 1..285 1..287 1262 89.5 Plus
Dere\GG14093-PA 272 GG14093-PA 27..269 24..260 446 42.4 Plus
Dere\GG14091-PA 290 GG14091-PA 56..284 39..260 432 40.6 Plus
Dere\GG15803-PA 260 GG15803-PA 29..259 30..260 429 39.6 Plus
Dere\GG15307-PA 270 GG15307-PA 46..265 38..256 426 39.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16196-PA 298 GH16196-PA 15..269 13..261 1068 77.3 Plus
Dgri\GH15022-PA 272 GH15022-PA 46..269 38..260 453 43.2 Plus
Dgri\GH23606-PA 220 GH23606-PA 15..217 59..260 436 44.2 Plus
Dgri\GH15030-PA 447 GH15030-PA 146..401 41..280 407 35.9 Plus
Dgri\GH16446-PA 290 GH16446-PA 56..284 39..260 390 38 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-PA 287 CG11529-PA 1..287 1..287 1530 100 Plus
CG10472-PA 290 CG10472-PA 57..284 40..260 428 41.6 Plus
Jon65Aiv-PA 271 CG6467-PA 46..270 38..260 425 40.8 Plus
CG10477-PB 272 CG10477-PB 27..269 24..260 422 40.6 Plus
CG10477-PA 272 CG10477-PA 27..269 24..260 422 40.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13345-PA 305 GI13345-PA 3..267 2..260 1087 77 Plus
Dmoj\GI16676-PA 273 GI16676-PA 44..268 36..258 450 41.2 Plus
Dmoj\GI16701-PA 290 GI16701-PA 56..284 39..260 434 41.5 Plus
Dmoj\GI12385-PA 264 GI12385-PA 31..260 37..260 426 40.4 Plus
Dmoj\GI12958-PA 279 GI12958-PA 52..276 36..260 409 39.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25164-PA 309 GL25164-PA 24..309 19..287 1196 81.5 Plus
Dper\GL15536-PA 274 GL15536-PA 49..271 40..260 437 40.3 Plus
Dper\GL15526-PA 289 GL15526-PA 55..283 39..260 430 41.9 Plus
Dper\GL25036-PA 263 GL25036-PA 36..260 36..260 426 40.2 Plus
Dper\GL15537-PA 274 GL15537-PA 49..271 40..260 426 38.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11053-PA 309 GA11053-PA 24..309 19..287 1196 81.5 Plus
Dpse\GA10335-PA 289 GA10335-PA 55..283 39..260 445 42.7 Plus
Dpse\GA19618-PA 274 GA19618-PA 49..271 40..260 434 39.8 Plus
Dpse\GA23594-PA 263 GA23594-PA 36..260 36..260 425 40.2 Plus
Dpse\GA19627-PA 274 GA19627-PA 50..271 40..260 422 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25336-PA 288 GM25336-PA 1..288 1..287 1415 94.4 Plus
Dsec\GM13877-PA 272 GM13877-PA 27..269 24..260 459 41.7 Plus
Dsec\GM13874-PA 290 GM13874-PA 56..284 39..260 431 40.6 Plus
Dsec\GM14745-PA 420 GM14745-PA 116..344 41..260 387 37.1 Plus
Dsec\GM14741-PA 274 GM14741-PA 44..271 34..260 375 36 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14368-PA 288 GD14368-PA 1..288 1..287 1491 95.8 Plus
Dsim\GD13160-PA 272 GD13160-PA 34..269 24..260 435 41.2 Plus
Dsim\GD13918-PA 272 GD13918-PA 33..269 23..260 435 40.1 Plus
Dsim\GD13922-PA 271 GD13922-PA 46..270 38..260 432 40.8 Plus
Dsim\GD13158-PA 290 GD13158-PA 56..284 39..260 429 40.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13174-PA 295 GJ13174-PA 22..266 24..261 1080 82.9 Plus
Dvir\GJ12928-PA 274 GJ12928-PA 45..271 36..260 477 44.3 Plus
Dvir\GJ12437-PA 290 GJ12437-PA 56..284 39..260 415 40.2 Plus
Dvir\GJ13101-PA 249 GJ13101-PA 24..244 36..256 414 38.7 Plus
Dvir\GJ12274-PA 263 GJ12274-PA 30..259 37..260 396 38.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25485-PA 272 GK25485-PA 19..254 25..261 1113 85.7 Plus
Dwil\GK17275-PA 297 GK17275-PA 63..289 39..258 438 42.7 Plus
Dwil\GK11558-PA 263 GK11558-PA 39..260 40..260 425 40 Plus
Dwil\GK17276-PA 290 GK17276-PA 58..284 39..260 425 41.2 Plus
Dwil\GK16888-PA 274 GK16888-PA 47..271 38..260 420 39 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Est-6-PA 292 GE21894-PA 1..292 1..287 1369 90.4 Plus
Dyak\GE21528-PA 273 GE21528-PA 46..270 38..260 471 43 Plus
Dyak\GE20514-PA 290 GE20514-PA 56..284 39..260 429 41 Plus
Dyak\GE22139-PA 260 GE22139-PA 35..259 36..260 415 40.6 Plus
Dyak\GE22140-PA 260 GE22140-PA 35..259 36..260 410 40.2 Plus

IP09419.hyp Sequence

Translation from 116 to 979

> IP09419.hyp
MIHKSIAHLLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQVMLIGK
QLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGL
VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQ
FAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICA
KGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTH
YLDWIESKIGSHGQVHQQYLRPQQQHHHHQYSDNNLI*

IP09419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG11529-PA 287 CG11529-PA 1..287 1..287 1530 100 Plus
CG10472-PA 290 CG10472-PA 57..284 40..260 428 41.6 Plus
Jon65Aiv-PA 271 CG6467-PA 46..270 38..260 425 40.8 Plus
CG10477-PB 272 CG10477-PB 27..269 24..260 422 40.6 Plus
CG10477-PA 272 CG10477-PA 27..269 24..260 422 40.6 Plus