Clone IP09881 Report

Search the DGRC for IP09881

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:81
Vector:pOT2
Associated Gene/Transcriptlcs-RA
Protein status:IP09881.pep: gold
Preliminary Size:792
Sequenced Size:536

Clone Sequence Records

IP09881.complete Sequence

536 bp assembled on 2010-11-10

GenBank Submission: BT125771.1

> IP09881.complete
ATAACGAAATGCGTACCCTTATCCTTGTTACTCTTGTTGCCCTGGTCGCA
GTGGCCTCCGCCCAAGGACCTGGTCCTTGGGGTCCCGGTGGACCTGGTGG
ACCTGGTGGACCAGGTCGTGGTCGCGGAGGACCAGGACGTGGACCTGGCG
GACCAGGTGGCCCAGGAGGTCGCGGACCTGGAGGACCTGGAGGACCAGGA
GGCCCAGGAGGCCCAGGAGGACCAGGAGGACCAGGAGGCCCAGGAGGACC
AGGATGCCCAGGAGGACCAGGTGGACCAGGAGGCCCCAAACCATGGGGAC
CTCCATCCAACCAAACCACATCCACGACAACTGAGGCCTCAACAAGCACT
TCCACCACGACAGCTTCGTCCACTACAGTGTCCTCCACTACAGAGTCCTC
TACGGAATCCTCGACGGAATCATCCACAGCATCCTCCACAGAATAAATCG
CTTGACATGTTCCCCTTCGAGTTTTGCCCATTCGGCTATTCCGGGTTCAT
AAATAATTGTATATATCAAAAAAAAAAAAAAAAAAA

IP09881.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21261930..21262446 517..1 2585 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
lcs-RA 438 CG12794-PA 1..438 9..446 2190 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
lcs-RA 590 CG12794-RA 29..545 1..517 2585 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 16:08:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21396767..21397288 522..1 2610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21381859..21382380 522..1 2610 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:08:43 has no hits.

IP09881.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:44:46 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21261930..21262163 284..517 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-11-12 11:09:06 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 1..438 9..446 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:42:29 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 1..438 9..446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:23:43 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 1..438 9..446 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:44:46 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 1..438 9..446 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-11-12 11:09:05 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 12..528 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:42:29 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 12..528 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:23:43 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 12..528 1..517 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:44:46 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
lcs-RA 29..545 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:44:46 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
X 21396772..21397288 1..517 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:23:43 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21267799..21268315 1..517 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:43 Download gff for IP09881.complete
Subject Subject Range Query Range Percent Splice Strand
X 21381864..21382380 1..517 100   Minus

IP09881.hyp Sequence

Translation from 0 to 516

> IP09881.hyp
ITKCVPLSLLLLLPWSQWPPPKDLVLGVPVDLVDLVDQVVVAEDQDVDLA
DQVAQEVADLEDLEDQEAQEAQEDQEDQEAQEDQDAQEDQVDQEAPNHGD
LHPTKPHPRQLRPQQALPPRQLRPLQCPPLQSPLRNPRRNHPQHPPQNKS
LDMFPFEFCPFGYSGFINNCIY
Sequence IP09881.hyp has no blast hits.

IP09881.pep Sequence

Translation from 8 to 445

> IP09881.pep
MRTLILVTLVALVAVASAQGPGPWGPGGPGGPGGPGRGRGGPGRGPGGPG
GPGGRGPGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGGPGGPKPWGPPS
NQTTSTTTEASTSTSTTTASSTTVSSTTESSTESSTESSTASSTE*

IP09881.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
lcs-PA 145 CG12794-PA 1..145 1..145 805 100 Plus
CG10918-PA 183 CG10918-PA 1..168 1..145 348 50.9 Plus
Mur82C-PB 578 CG12586-PB 406..476 22..93 339 84.9 Plus
Mur82C-PB 578 CG12586-PB 401..485 23..107 331 72.4 Plus
Mur82C-PB 578 CG12586-PB 390..473 16..98 315 72.7 Plus
Mur82C-PB 578 CG12586-PB 403..477 14..88 312 77.9 Plus
Mur82C-PB 578 CG12586-PB 415..478 20..83 300 83.6 Plus
CG13947-PA 119 CG13947-PA 1..117 1..135 282 55.1 Plus
Cpr47Ef-PC 612 CG13214-PC 464..558 21..102 240 57.9 Plus