Clone IP12954 Report

Search the DGRC for IP12954

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:129
Well:54
Vector:pOT2
Associated Gene/TranscriptCG13801-RA
Protein status:IP12954.pep: gold
Preliminary Size:2073
Sequenced Size:2203

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13801 2005-01-01 Successful iPCR screen
CG13801 2008-04-29 Release 5.5 accounting
CG13801 2008-08-15 Release 5.9 accounting
CG13801 2008-12-18 5.12 accounting

Clone Sequence Records

IP12954.complete Sequence

2203 bp (2203 high quality bases) assembled on 2006-04-05

GenBank Submission: BT025092

> IP12954.complete
TGAACGACCATGAATCCAATTATCAAGAAATATCGCCTGAGGCTAAGGAG
AACTGAACGGGACTCGACCATTGGCTATGTGTTTCGCATCATCCGAATTG
TCATTCTATTGTCTCTCTGGACCGGATCCACGATCATCCTGTTTCTCCAC
AAGCCTGAAGAGCTCGCCACGTCGATGGTGACCGTGATGCCCAACAAGAC
GGCCTTCCGGAATGTTAAGATGAAGCAGGATTCCGTGGAGATACGCCTGA
ATGGTGCCATAAATGCGTATCTGACTAACCACAGGGTTAGGACATCCAAC
TTTTCGGCTGTTGGAGTTCGATTGGAGTGGCGGGATCGAGGAATGAATCG
TAGCCTTTGGCGCACTGGCATGTGGATGGTGTACATGTACAAGGATAAGA
AGAAGTACCTGCAGGTTAATAGGGTCTTTCAGTTCTCCATTTCAGGATGG
CAACAGGAGAGGTCCCTGATCCAGCGTACTTTGCCAACTGATCGTAGTCT
TGAGAACTCCGTCTATGACTGGGCCTTTGCGCAGACGGTGATCTCATTCG
AGAGCATGAGCAAGGATCCGGTGGGTCTGCTCATGACGGTGAACAGCACT
CCGTTGGAGCACGGACTGGGTATACTGTATGCCGCCCTTCTGCTAATCGG
TCTATATGCCATTATTATCTGGGAATTTTCGGACCGTATTCTAAGCACTT
TGCTCATAACAGCTATGTCCCTCGCCCTGCTCACCGTTTTGGGGAGCAGG
CCCACTCTGGAAACGATTGTGAGTTGGGTGGACTGGGAGACCATGATGCT
CCTGCTGGGCAATATGATTATAACATCGCGCATGGCAGATACAGGCTTCT
TTGACTACCTGGCCGTGGTCGCCTATCGCATCTCCAAGGGCCATGCCTGG
CTGCTGATCGGTCTTTTGGGATTCTTCGTGGGATTGACCTCGACTGTTGT
GGACAATGCCACCGTGGTGCTTCTCTTCTGCCCACCCGTCATTCGATTGT
GCGAGGTAATGGACTTGAGGACCACCTTGGTGCTCATCATTGTAGCAATC
TATGCAAATATCGGTGGGTCCATTACCCCAGTGAGTGGGCCACCCAATAC
CATCATAGCGACCAATAAGATGGTGGAGTCCGCAGGTATTAATTTTGTTC
GTTTCTCGCTACTCATGCTTCCGACTGCTTTGATTTGCCTGGCGTCTACC
TTTGGCCTAATCTACTGGACCATGGGTAAGAAGATCTACATTCTGGACGA
AGATCAGGTGAACCTAGCAGAGAAGCGGCGAGAAAATACCAGAACCTCTT
TTGATATCCAGCTGAGGGTCGCCGAACTGCGAAGACAGCCAAGGAGCAAG
GTAATCCCTCCAGCTGAGAGCTACTTCATAACACTGGCAACCTTGGAGGC
GAGCAATTTTGTCCGCAAGAAGGTGCTGCTGGTGGAATCCCTTCTGGCCC
TGAGCTTTGCCGCCTTCTGCTTCATTCTGCAATCGGTTCCATGGGCCATT
CCCGGAGCCTCTCTGGGCTGGATATCAATTCTGTCCGCCTTTCTGCTGCT
CATCCTGATCGACCAGAAGGATATCATCAAGGTCATGGCCAGCGTCGAGT
GGGGCATCATGCTGCTGCTCGCTTCTCTCTTCATTTTCACCATGGTCGTC
GATGAACTGGGCCTCATCCACTGGTTGGGCTCTCAGGTGGTGTCTGTGAT
CCTCCGAGTGGACGAATCATACCAGACCATGGTCGGTATGCTCCTGATCC
TCTGGCTTTCGGCCCTGCTCTCCGCCTTTATTCACAATGCGGCGGTGGCA
CCCATCATGGTGAAACTCTGCACTGACATGGTCGTATATGACCAGGTCCA
GATGCCCCTACTGCCGCTCATCTGGGCCACAAGCATGGGCACCAGCTACG
GTGCCAATGGCACTCTCTTGGGCTCCCTGGCCAACGAGTTCGCCGCGGTG
GTGGGCAAAGCTCATGGCTACAAGATCACCTTCAGGTCATTCTTTGTGGT
TGGTTTCCTAATCATGCTATTCACCGTTGTCATCTGCTCGATTTTCCTAA
TTATTGCCCACTCAATTTTTGATTGGCATTAGATTAGGTTAGGCCTTCAT
TTGTTTATAATAATATGTATACTACATTTTAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP12954.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-RA 2130 CG13801-RA 1..2130 1..2130 10650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2360019..2362148 1..2130 10455 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-RA 2073 CG13801-PA 1..2073 10..2082 10365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:17:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-RA 2130 CG13801-RA 1..2130 1..2130 10650 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-PA 690 CG13801-PA 1..690 10..2079 3132 100 Plus
CG11262-PA 702 CG11262-PA 57..700 76..2079 1230 43.5 Plus
CG31693-PA 688 CG31693-PA 49..683 79..2079 986 37.3 Plus
CG31693-PB 607 CG31693-PB 1..602 175..2079 940 37.5 Plus
hoe1-PH 658 CG12787-PH 122..658 532..2079 816 39.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2360557..2362689 1..2133 10665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2360557..2362689 1..2133 10665 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:03:09 has no hits.

IP12954.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:17:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2360019..2362148 1..2130 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:54:00 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:01 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:51 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:36:02 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:01 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2130 1..2130 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2130 1..2130 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:52 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2073 10..2082 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
CG13801-RA 1..2130 1..2130 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:17:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2360557..2362686 1..2130 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:09 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2360557..2362686 1..2130 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:25 Download gff for IP12954.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2360557..2362686 1..2130 100   Plus

IP12954.pep Sequence

Translation from 9 to 2081

> IP12954.pep
MNPIIKKYRLRLRRTERDSTIGYVFRIIRIVILLSLWTGSTIILFLHKPE
ELATSMVTVMPNKTAFRNVKMKQDSVEIRLNGAINAYLTNHRVRTSNFSA
VGVRLEWRDRGMNRSLWRTGMWMVYMYKDKKKYLQVNRVFQFSISGWQQE
RSLIQRTLPTDRSLENSVYDWAFAQTVISFESMSKDPVGLLMTVNSTPLE
HGLGILYAALLLIGLYAIIIWEFSDRILSTLLITAMSLALLTVLGSRPTL
ETIVSWVDWETMMLLLGNMIITSRMADTGFFDYLAVVAYRISKGHAWLLI
GLLGFFVGLTSTVVDNATVVLLFCPPVIRLCEVMDLRTTLVLIIVAIYAN
IGGSITPVSGPPNTIIATNKMVESAGINFVRFSLLMLPTALICLASTFGL
IYWTMGKKIYILDEDQVNLAEKRRENTRTSFDIQLRVAELRRQPRSKVIP
PAESYFITLATLEASNFVRKKVLLVESLLALSFAAFCFILQSVPWAIPGA
SLGWISILSAFLLLILIDQKDIIKVMASVEWGIMLLLASLFIFTMVVDEL
GLIHWLGSQVVSVILRVDESYQTMVGMLLILWLSALLSAFIHNAAVAPIM
VKLCTDMVVYDQVQMPLLPLIWATSMGTSYGANGTLLGSLANEFAAVVGK
AHGYKITFRSFFVVGFLIMLFTVVICSIFLIIAHSIFDWH*

IP12954.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23750-PA 708 GF23750-PA 62..701 27..690 1306 42.9 Plus
Dana\GF21545-PA 847 GF21545-PA 311..847 175..690 993 39.6 Plus
Dana\GF21513-PA 685 GF21513-PA 32..685 6..690 933 31.9 Plus
Dana\GF21544-PA 852 GF21544-PA 332..852 190..690 736 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14859-PA 681 GG14859-PA 1..681 1..690 2856 80.7 Plus
Dere\GG15613-PA 665 GG15613-PA 10..663 12..690 1284 44 Plus
Dere\GG21352-PA 637 GG21352-PA 1..637 30..690 1168 38.6 Plus
Dere\GG24342-PA 846 GG24342-PA 310..846 175..690 994 39.6 Plus
Dere\GG24341-PA 846 GG24341-PA 342..846 204..690 718 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13602-PA 711 GH13602-PA 26..705 13..690 1030 33.2 Plus
Dgri\GH10104-PA 855 GH10104-PA 320..855 176..690 999 39.5 Plus
Dgri\GH13310-PA 1049 GH13310-PA 377..1049 27..690 987 34.7 Plus
Dgri\GH10103-PA 881 GH10103-PA 377..880 204..689 715 33.9 Plus
Dgri\GH12246-PA 590 GH12246-PA 300..521 204..425 348 36.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-PA 690 CG13801-PA 1..690 1..690 3485 100 Plus
CG11262-PA 702 CG11262-PA 57..700 23..690 1449 43.5 Plus
CG31693-PA 688 CG31693-PA 49..683 24..690 1177 37.3 Plus
CG31693-PB 607 CG31693-PB 1..602 56..690 1131 37.5 Plus
hoe1-PH 658 CG12787-PH 122..658 175..690 1012 39.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14413-PA 805 GI14413-PA 270..805 176..690 1006 39.9 Plus
Dmoj\GI18174-PA 703 GI18174-PA 83..703 70..690 971 34.3 Plus
Dmoj\GI14395-PA 852 GI14395-PA 369..852 225..690 710 34.3 Plus
Dmoj\GI18175-PA 692 GI18175-PA 12..688 11..690 638 25.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15458-PA 700 GL15458-PA 22..698 11..690 1324 41.7 Plus
Dper\GL19493-PA 860 GL19493-PA 324..860 175..690 1000 40 Plus
Dper\GL19492-PA 849 GL19492-PA 344..849 203..690 716 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29039-PA 681 GA29039-PA 22..680 11..672 1262 41.6 Plus
Dpse\GA11811-PA 860 GA11811-PA 324..860 175..690 998 40 Plus
Dpse\GA13854-PA 849 GA13854-PA 344..849 203..690 717 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14485-PA 690 GM14485-PA 1..690 1..690 3366 93.8 Plus
Dsec\GM25385-PA 702 GM25385-PA 46..700 12..690 1282 43 Plus
Dsec\GM18063-PA 847 GM18063-PA 311..847 175..690 995 39.6 Plus
Dsec\GM16152-PA 573 GM16152-PA 1..573 56..690 862 33.2 Plus
Dsec\GM18062-PA 846 GM18062-PA 324..846 188..690 725 34.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14418-PA 702 GD14418-PA 46..700 12..690 1289 43.2 Plus
Dsim\GD24340-PA 602 GD24340-PA 1..602 56..690 1092 37.7 Plus
Dsim\GD22681-PA 812 GD22681-PA 276..812 175..690 995 39.6 Plus
Dsim\GD11986-PA 824 GD11986-PA 302..824 188..690 727 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14623-PA 1004 GJ14623-PA 368..1004 68..690 1068 37.9 Plus
Dvir\GJ14626-PA 712 GJ14626-PA 20..706 9..690 1037 34.4 Plus
Dvir\GJ16262-PA 850 GJ16262-PA 315..850 176..690 1006 40.2 Plus
Dvir\GJ16261-PA 849 GJ16261-PA 255..849 124..690 748 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19368-PA 660 GK19368-PA 3..660 29..690 1130 37.1 Plus
Dwil\GK24590-PA 824 GK24590-PA 245..824 128..690 996 38.2 Plus
Dwil\GK24760-PA 502 GK24760-PA 1..502 190..690 965 41.9 Plus
Dwil\GK24588-PA 865 GK24588-PA 345..865 190..690 734 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20316-PA 681 GE20316-PA 1..681 1..690 2824 81.4 Plus
Dyak\GE21939-PA 659 GE21939-PA 21..657 23..690 1270 43.2 Plus
Dyak\GE18721-PA 846 GE18721-PA 310..846 175..690 994 39.6 Plus
Dyak\GE18720-PA 844 GE18720-PA 340..844 204..690 722 34.2 Plus
Dyak\GE12933-PA 454 GE12933-PA 175..428 419..673 462 40.6 Plus

IP12954.hyp Sequence

Translation from 9 to 2081

> IP12954.hyp
MNPIIKKYRLRLRRTERDSTIGYVFRIIRIVILLSLWTGSTIILFLHKPE
ELATSMVTVMPNKTAFRNVKMKQDSVEIRLNGAINAYLTNHRVRTSNFSA
VGVRLEWRDRGMNRSLWRTGMWMVYMYKDKKKYLQVNRVFQFSISGWQQE
RSLIQRTLPTDRSLENSVYDWAFAQTVISFESMSKDPVGLLMTVNSTPLE
HGLGILYAALLLIGLYAIIIWEFSDRILSTLLITAMSLALLTVLGSRPTL
ETIVSWVDWETMMLLLGNMIITSRMADTGFFDYLAVVAYRISKGHAWLLI
GLLGFFVGLTSTVVDNATVVLLFCPPVIRLCEVMDLRTTLVLIIVAIYAN
IGGSITPVSGPPNTIIATNKMVESAGINFVRFSLLMLPTALICLASTFGL
IYWTMGKKIYILDEDQVNLAEKRRENTRTSFDIQLRVAELRRQPRSKVIP
PAESYFITLATLEASNFVRKKVLLVESLLALSFAAFCFILQSVPWAIPGA
SLGWISILSAFLLLILIDQKDIIKVMASVEWGIMLLLASLFIFTMVVDEL
GLIHWLGSQVVSVILRVDESYQTMVGMLLILWLSALLSAFIHNAAVAPIM
VKLCTDMVVYDQVQMPLLPLIWATSMGTSYGANGTLLGSLANEFAAVVGK
AHGYKITFRSFFVVGFLIMLFTVVICSIFLIIAHSIFDWH*

IP12954.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13801-PA 690 CG13801-PA 1..690 1..690 3485 100 Plus
CG11262-PA 702 CG11262-PA 57..700 23..690 1449 43.5 Plus
CG31693-PA 688 CG31693-PA 49..683 24..690 1177 37.3 Plus
CG31693-PB 607 CG31693-PB 1..602 56..690 1131 37.5 Plus
hoe1-PH 658 CG12787-PH 122..658 175..690 1012 39.6 Plus