Clone IP14940 Report

Search the DGRC for IP14940

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:149
Well:40
Vector:pOT2
Associated Gene/Transcriptcora-RC
Protein status:IP14940.pep: gold
Sequenced Size:2902

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
cora 2008-04-29 Release 5.5 accounting
cora 2008-08-15 Release 5.9 accounting
cora 2008-12-18 5.12 accounting

Clone Sequence Records

IP14940.complete Sequence

2902 bp (2902 high quality bases) assembled on 2006-03-22

GenBank Submission: BT024976

> IP14940.complete
CACATCGAATATTTGTGAAGACGGTATTCAACGACGACGACGACGACAAC
AACAAATTGTCTTTTTTCGCGAACGAATAGAAAAAAGTGGCAAAGAATTT
GTTTACTAGTGTGAAAGCGAGTGAGTGCAGTGCCCACGGGAGAAAAGTGA
AAACAACACAAATACAGGAGTAAAAATCAGCCAACCGCCAAACTAACGGT
AACTGCGTGTCCTTGCTGTGGATTAAAAAGGATTCTAGAGGCGTCTTAAA
AGGCTCGCTGGAAATCATTGCCGGAGAAATTCTAGAGCTCTTTGGAACCA
ACTCCAAGCTGTCGCTGGCGTAGCCAAGTCCCCCAATCCAAGATGCCGGC
GGAAATTAAACCATCCGCGCCCGCTGAGCCGGAAACGCCGACCAAGAGCA
AACCCAAGTCCAGCTCATCCTCGCACGGAAAGCCTGCCCTAGCACGAGTC
ACCCTGCTGGATGGCTCCCTTCTGGACGTGTCCATTGATCGCAAAGCCAT
TGGCCGTGATGTGATCAACTCAATCTGCGCCGGTCTGAACCTCATCGAAA
AGGACTACTTTGGTCTGACCTATGAGACGCCCACAGATCCGCGCACTTGG
CTGGATCTGGAGAAGCCGGTATCCAAGTTCTTCCGCACGGACACTTGGCC
TCTCACCTTCGCCGTCAAGTTCTATCCGCCGGAGCCATCGCAGCTGAAGG
AGGACATCACGCGCTACCATTTGTGCCTGCAGGTGCGCAATGACATCCTG
GAGGGTCGACTGCCCTGCACATTCGTCACCCACGCTCTGCTCGGATCCTA
CTTGGTGCAGTCGGAGATGGGCGACTACGATGCAGAGGAAATGCCCACCA
GGGCCTACCTGAAGGACTTCAAGATCGCTCCAAATCAGACGGCTGAGTTG
GAGGATAAGGTCATGGATCTTCACAAGACCCACAAGGGACAATCGCCCGC
CGAGGCTGAGCTACACTACCTGGAGAATGCCAAGAAGCTGGCCATGTACG
GCGTGGACTTGCATCCCGCTAAGGATTCTGAGGGCGTGGACATCATGCTG
GGCGTTTGTGCCTCCGGTTTGCTCGTCTACCGCGATAAATTGCGCATCAA
CCGCTTTGCCTGGCCCAAGATTCTGAAGATCTCCTACAAGCGCCACCATT
TCTACATCAAGATCCGACCGGGTGAATTCGAGCAGTACGAATCCACCATT
GGCTTTAAGCTGGCCAACCATCGTGCCGCCAAGAAACTGTGGAAATCCTG
CGTGGAGCACCACACCTTCTTCCGCCTGATGACCCCCGAACCGGTCAGCA
AGTCCAAGATGTTCCCAGTCTTCGGGTCCACCTATCGCTACAAGGGTCGC
ACTCAGGCCGAGAGCACGAACACACCCGTGGATCGTACTCCTCCGAAGTT
CAATAGGACTCTGTCCGGAGCTCGTCTCACTTCCAGGAGCATGGATGCTC
TGGCCTTGGCCGAAAAGGAAAAGGTGGCTAGGAAGAGCAGCACCCTGGAT
CATCGGGGAGATCGCAATGCCGATGGCGATGCCCACAGCCGCAGTCCCAT
CAAGAACAAGAAGGAGAAGTTGATGCGACAGTCGAGCACCGGCACGGCTT
CGGCCTCCTCGCAAAGTTCCCTCGAGGGTGACTACGAGACCAACCTAGAG
ATTGAGGCCATCGAGGCTGAGCCCCCCGTTCAGGATGCTGATAAGGAGGC
TAAGTTGCGTGAGAAGAAACAAAAGGAGAAGGAGGAGAAGGAGCGAAAGG
AGCGGGAGAAGCGGGAGTTGGAGGAGAAGAAGAAGGCCGAAAAGGCTGCC
AAGGCAGCACTTGCCGCTGGTGCCGCTGCAGGAGCGGCTGTTAATGGCAA
TGACGAGCTGAATGATTCCAACAAGTCTGACAAGTCCTCAGGCAGACGTG
CTGATGCTACACCCACCGACCTGAGTGGCGCCTATGTCACGGCCACCGCA
GTCACCACCCGCACCGCCACCACGCACGAGGATCTGGGCAAGAACGCCAA
GACGGAGCAGCTGGAGGAGAAGACGGTGGCCACCACCCGCACCCACGATC
CCAACAAGCAGCAGCAGCGCGTCGTTACCCAGGAGGTGAAGACGACGGCG
ACGGTCACCAGTGGGGATCAGAAATCTCCGCTGTTTACGACCTCCGCCAC
CACTGGACCCCATGTGGAAAGCACCCGAGTGGTTCTCGGTGAGGACACAC
CCGGATTCTCCGGACATGGCGAAATCATCTCCACCCAAACCGTGAGCAGC
AAAACCCGCACTGTGGAAACCATTACCTACAAAACCGAACGCGATGGCAT
TGTGGAGACCCGAGTGGAACAGAAGATAACCATTCAGTCCGATGGAGATC
CGATCGATCATGACAAAGCCTTGGCCGAGGCAATACAAGAAGCGACGGCC
ATGAATCCGGACATGACAGTCGAGAAGATTGAAATTCAGCAGCAAACGCA
GTAGATTTTATAATTATTTTTAAACCATTCGGATGATTTTCTAAGTAAAC
CCGCACACACACTCACACACATGAACACCAGCCCACGCATACGCAGCACT
TGCAGTACACCTTTTATACAACCTATATCTAAATATAATTTAAACAAATA
TATATATATATACACACGAGTGTATATTTGAGCTCGAGCTGATGACCCAC
ATGACATAACACTAAGAAACATAAAAAGATAAATTCCCAATTATCCGTTA
CCGCAACCGTCTACGAGAAAATGCATCTACATGTTTATTATTTTTATTAC
AACTGTTGTTTATAATTACTTTTTATTACGTATATTATATATTGAATGTG
CAAGGCAACGTTGAAATGAAAACTCTATATATTGTAAACCACGATTGCAT
TCAAATACAAGAATAAAACCTAAATGTACACACACAAAAAAAAAAAAAAA
AA

IP14940.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
cora-RC 2912 cora-RC 28..2912 1..2885 14425 100 Plus
cora.f 2868 cora.f 281..2868 298..2885 12940 100 Plus
cora-RB 3490 cora-RB 47..1616 1..1570 7850 100 Plus
cora-RB 3490 cora-RB 2504..3490 1900..2886 4935 100 Plus
cora-RB 3490 cora-RB 1614..1934 1580..1900 1605 100 Plus
cora.f 2868 cora.f 28..281 1..254 1270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15130428..15130929 2384..2885 2495 99.8 Plus
chr2R 21145070 chr2R 15122945..15123391 490..936 2190 99.3 Plus
chr2R 21145070 chr2R 15123667..15124025 1089..1447 1795 100 Plus
chr2R 21145070 chr2R 15116612..15116842 23..253 1125 99.1 Plus
chr2R 21145070 chr2R 15129351..15129572 1900..2121 1110 100 Plus
chr2R 21145070 chr2R 15122653..15122844 298..489 960 100 Plus
chr2R 21145070 chr2R 15125325..15125492 1680..1847 825 99.4 Plus
chr2R 21145070 chr2R 15129878..15130036 2119..2277 795 100 Plus
chr2R 21145070 chr2R 15123449..15123601 936..1088 720 98 Plus
chr2R 21145070 chr2R 15124123..15124245 1447..1569 585 98.4 Plus
chr2R 21145070 chr2R 15124505..15124621 1568..1684 585 100 Plus
chr2R 21145070 chr2R 15130247..15130358 2278..2389 560 100 Plus
chr2R 21145070 chr2R 15125558..15125612 1846..1900 275 100 Plus
chr2R 21145070 chr2R 15122312..15122356 253..297 225 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
cora-RC 2112 CG11949-PC 1..2112 343..2454 10560 100 Plus
cora-RB 2670 CG11949-PB 1..1546 343..1900 7575 99.2 Plus
cora-RG 5091 CG11949-PG 1..1227 343..1569 6135 100 Plus
cora-RB 2670 CG11949-PB 2116..2670 1900..2454 2775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:23:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
cora-RC 2914 CG11949-RC 30..2914 1..2885 14425 100 Plus
cora-RB 3472 CG11949-RB 30..1917 1..1900 9285 99.4 Plus
cora-RG 5893 CG11949-RG 30..1598 1..1569 7845 100 Plus
cora-RB 3472 CG11949-RB 2487..3472 1900..2885 4930 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
cora-PC 703 CG11949-PC 1..695 343..2427 3047 100 Plus
cora-PB 889 CG11949-PB 1..526 343..1932 2218 97.7 Plus
cora-PE 699 CG11949-PE 1..409 343..1569 2057 100 Plus
cora-PF 1600 CG11949-PF 1..409 343..1569 2057 100 Plus
cora-PG 1696 CG11949-PG 1..409 343..1569 2057 100 Plus
cora-PE 699 CG11949-PE 462..691 1840..2427 871 85.2 Plus
cora-PB 889 CG11949-PB 705..881 1897..2427 815 99.4 Plus
cora-PF 1600 CG11949-PF 1467..1592 2041..2427 526 83.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19243250..19243758 2384..2892 2530 99.8 Plus
2R 25286936 2R 19235763..19236209 490..936 2235 100 Plus
2R 25286936 2R 19236485..19236843 1089..1447 1795 100 Plus
2R 25286936 2R 19229423..19229653 23..253 1155 100 Plus
2R 25286936 2R 19242174..19242395 1900..2121 1110 100 Plus
2R 25286936 2R 19235471..19235662 298..489 960 100 Plus
2R 25286936 2R 19238148..19238315 1680..1847 840 100 Plus
2R 25286936 2R 19242701..19242859 2119..2277 795 100 Plus
2R 25286936 2R 19236267..19236419 936..1088 765 100 Plus
2R 25286936 2R 19236941..19237063 1447..1569 615 100 Plus
2R 25286936 2R 19237326..19237442 1568..1684 585 100 Plus
2R 25286936 2R 19243069..19243180 2278..2389 560 100 Plus
2R 25286936 2R 19238381..19238435 1846..1900 275 100 Plus
2R 25286936 2R 19235120..19235164 253..297 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19244449..19244957 2384..2892 2530 99.8 Plus
2R 25260384 2R 19236962..19237408 490..936 2235 100 Plus
2R 25260384 2R 19237684..19238042 1089..1447 1795 100 Plus
2R 25260384 2R 19230622..19230852 23..253 1155 100 Plus
2R 25260384 2R 19243373..19243594 1900..2121 1110 100 Plus
2R 25260384 2R 19236670..19236861 298..489 960 100 Plus
2R 25260384 2R 19239347..19239514 1680..1847 840 100 Plus
2R 25260384 2R 19243900..19244058 2119..2277 795 100 Plus
2R 25260384 2R 19237466..19237618 936..1088 765 100 Plus
2R 25260384 2R 19238140..19238262 1447..1569 615 100 Plus
2R 25260384 2R 19238525..19238641 1568..1684 585 100 Plus
2R 25260384 2R 19244268..19244379 2278..2389 560 100 Plus
2R 25260384 2R 19239580..19239634 1846..1900 275 100 Plus
2R 25260384 2R 19236319..19236363 253..297 225 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:19:21 has no hits.

IP14940.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:09:56 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15130433..15130929 2389..2885 93   Plus
chr2R 15130247..15130357 2278..2388 100 -> Plus
chr2R 15129881..15130036 2122..2277 100 -> Plus
chr2R 15129351..15129572 1900..2121 100 -> Plus
chr2R 15125559..15125611 1847..1899 100 -> Plus
chr2R 15125434..15125491 1789..1846 100 -> Plus
chr2R 15125329..15125356 1684..1711 100 == Plus
chr2R 15124507..15124620 1570..1683 100 -> Plus
chr2R 15124124..15124245 1448..1569 98 -> Plus
chr2R 15123667..15124025 1089..1447 100 -> Plus
chr2R 15123449..15123601 936..1088 98 -> Plus
chr2R 15122945..15123390 490..935 99 -> Plus
chr2R 15122653..15122844 298..489 100 -> Plus
chr2R 15122313..15122356 254..297 100 -> Plus
chr2R 15116613..15116842 24..253 99 -> Plus
chr2R 15116281..15116303 1..23 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:47:01 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 1..2112 343..2454 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:12 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 1..2112 343..2454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:41:46 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 1..2112 343..2454 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:39:50 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 1..2112 343..2454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:56 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 1..2112 343..2454 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:47:00 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 28..2912 1..2885 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:12 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 28..2912 1..2885 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:41:46 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 30..2914 1..2885 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:39:50 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 28..2912 1..2885 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:56 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 30..2914 1..2885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:09:56 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19243255..19243751 2389..2885 100   Plus
2R 19243069..19243179 2278..2388 100 -> Plus
2R 19242704..19242859 2122..2277 100 -> Plus
2R 19242174..19242395 1900..2121 100 -> Plus
2R 19238382..19238434 1847..1899 100 -> Plus
2R 19238152..19238314 1684..1846 100 -> Plus
2R 19237328..19237441 1570..1683 100 -> Plus
2R 19236942..19237063 1448..1569 100 -> Plus
2R 19236485..19236843 1089..1447 100 -> Plus
2R 19236267..19236419 936..1088 100 -> Plus
2R 19235763..19236208 490..935 100 -> Plus
2R 19235471..19235662 298..489 100 -> Plus
2R 19235121..19235164 254..297 100 -> Plus
2R 19229424..19229653 24..253 100 -> Plus
2R 19229092..19229114 1..23 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:41:46 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15130760..15131256 2389..2885 100   Plus
arm_2R 15130574..15130684 2278..2388 100 -> Plus
arm_2R 15130209..15130364 2122..2277 100 -> Plus
arm_2R 15129679..15129900 1900..2121 100 -> Plus
arm_2R 15125887..15125939 1847..1899 100 -> Plus
arm_2R 15125657..15125819 1684..1846 100 -> Plus
arm_2R 15124833..15124946 1570..1683 100 -> Plus
arm_2R 15124447..15124568 1448..1569 100 -> Plus
arm_2R 15123990..15124348 1089..1447 100 -> Plus
arm_2R 15123772..15123924 936..1088 100 -> Plus
arm_2R 15123268..15123713 490..935 100 -> Plus
arm_2R 15122976..15123167 298..489 100 -> Plus
arm_2R 15122626..15122669 254..297 100 -> Plus
arm_2R 15116929..15117158 24..253 100 -> Plus
arm_2R 15116597..15116619 1..23 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:18:40 Download gff for IP14940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19244454..19244950 2389..2885 100   Plus
2R 19244268..19244378 2278..2388 100 -> Plus
2R 19243903..19244058 2122..2277 100 -> Plus
2R 19243373..19243594 1900..2121 100 -> Plus
2R 19239581..19239633 1847..1899 100 -> Plus
2R 19239351..19239513 1684..1846 100 -> Plus
2R 19238527..19238640 1570..1683 100 -> Plus
2R 19238141..19238262 1448..1569 100 -> Plus
2R 19237684..19238042 1089..1447 100 -> Plus
2R 19237466..19237618 936..1088 100 -> Plus
2R 19236962..19237407 490..935 100 -> Plus
2R 19236670..19236861 298..489 100 -> Plus
2R 19236320..19236363 254..297 100 -> Plus
2R 19230623..19230852 24..253 100 -> Plus
2R 19230291..19230313 1..23 100 -> Plus

IP14940.pep Sequence

Translation from 342 to 2453

> IP14940.pep
MPAEIKPSAPAEPETPTKSKPKSSSSSHGKPALARVTLLDGSLLDVSIDR
KAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTD
TWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALL
GSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQ
SPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKL
RINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLW
KSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAESTNTPVDRTP
PKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSR
SPIKNKKEKLMRQSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQDAD
KEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAV
NGNDELNDSNKSDKSSGRRADATPTDLSGAYVTATAVTTRTATTHEDLGK
NAKTEQLEEKTVATTRTHDPNKQQQRVVTQEVKTTATVTSGDQKSPLFTT
SATTGPHVESTRVVLGEDTPGFSGHGEIISTQTVSSKTRTVETITYKTER
DGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQ
QTQ*

IP14940.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11579-PA 1749 GF11579-PA 1..534 1..520 2170 84.7 Plus
Dana\GF11579-PA 1749 GF11579-PA 1527..1749 519..703 757 80.3 Plus
Dana\GF18918-PA 4295 GF18918-PA 64..379 29..340 724 41.6 Plus
Dana\GF17780-PA 1275 GF17780-PA 5..313 54..358 639 41.7 Plus
Dana\GF17379-PA 988 GF17379-PA 59..392 34..365 602 38.8 Plus
Dana\GF24903-PA 954 GF24903-PA 19..327 29..342 597 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21953-PA 1743 GG21953-PA 1..520 1..520 2460 98.5 Plus
Dere\GG21953-PA 1743 GG21953-PA 1525..1743 519..703 817 83.1 Plus
Dere\GG12596-PA 1038 GG12596-PA 45..376 15..340 699 40.8 Plus
Dere\GG11802-PA 1287 GG11802-PA 18..324 54..358 639 41.3 Plus
Dere\GG17049-PA 983 GG17049-PA 64..414 34..384 609 37.8 Plus
Dere\GG14719-PA 952 GG14719-PA 19..327 29..342 603 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23092-PA 1732 GH23092-PA 1..514 1..520 2034 82.8 Plus
Dgri\GH23092-PA 1732 GH23092-PA 1515..1732 519..703 758 79.5 Plus
Dgri\GH23060-PA 4831 GH23060-PA 68..383 29..340 728 42.4 Plus
Dgri\GH15457-PA 982 GH15457-PA 37..348 36..342 698 43.6 Plus
Dgri\GH16444-PA 1357 GH16444-PA 14..341 35..358 645 40.5 Plus
Dgri\GH18540-PA 992 GH18540-PA 59..392 34..365 603 38.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
cora-PC 703 CG11949-PC 1..703 1..703 3610 100 Plus
cora-PE 699 CG11949-PE 1..699 1..703 3333 90.2 Plus
cora-PB 889 CG11949-PB 1..603 1..589 2680 87.8 Plus
cora-PF 1600 CG11949-PF 1..491 1..519 2460 93.1 Plus
cora-PG 1696 CG11949-PG 1..481 1..519 2454 92.7 Plus
cora-PB 889 CG11949-PB 705..889 519..703 926 99.5 Plus
cora-PF 1600 CG11949-PF 1467..1600 567..703 564 84.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18918-PA 1726 GI18918-PA 1..456 1..453 2093 86 Plus
Dmoj\GI18918-PA 1726 GI18918-PA 1506..1726 519..703 782 80.5 Plus
Dmoj\GI10248-PA 4195 GI10248-PA 67..382 29..340 735 42.6 Plus
Dmoj\GI16737-PA 974 GI16737-PA 37..348 36..342 704 43.9 Plus
Dmoj\GI22201-PA 1586 GI22201-PA 14..341 35..358 651 40.8 Plus
Dmoj\GI23239-PA 996 GI23239-PA 60..404 34..376 604 38.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17638-PA 1745 GL17638-PA 1..529 1..520 2233 85.5 Plus
Dper\GL17638-PA 1745 GL17638-PA 1525..1745 519..703 791 81 Plus
Dper\GL21623-PA 1144 GL21623-PA 68..383 29..340 710 41.6 Plus
Dper\GL27244-PA 1011 GL27244-PA 13..341 34..358 641 40.4 Plus
Dper\GL23983-PA 747 GL23983-PA 53..386 34..365 598 38.8 Plus
Dper\GL16093-PA 940 GL16093-PA 39..330 36..344 597 40.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11291-PD 716 GA11291-PD 1..716 1..703 3056 88.6 Plus
Dpse\GA11291-PC 905 GA11291-PC 1..539 1..530 2222 84.6 Plus
Dpse\GA11291-PF 1702 GA11291-PF 1..406 1..403 2055 90.6 Plus
Dpse\GA11291-PG 701 GA11291-PG 1..406 1..403 2041 90.6 Plus
Dpse\GA11291-PC 905 GA11291-PC 719..905 519..703 835 95.7 Plus
Dpse\GA11291-PF 1702 GA11291-PF 1482..1702 519..703 790 81 Plus
Dpse\GA30107-PA 1169 GA30107-PA 48..379 15..340 699 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21939-PA 1742 GM21939-PA 1..520 1..520 2444 99.2 Plus
Dsec\GM21939-PA 1742 GM21939-PA 1524..1742 519..703 823 84 Plus
Dsec\GM10783-PA 406 GM10783-PA 52..383 15..340 703 41.1 Plus
Dsec\GM12936-PA 1338 GM12936-PA 52..381 33..358 639 40.2 Plus
Dsec\GM25934-PA 980 GM25934-PA 63..412 34..383 614 38.2 Plus
Dsec\GM14335-PA 952 GM14335-PA 19..327 29..342 598 39.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11436-PA 1393 GD11436-PA 1..520 1..520 2817 99.4 Plus
Dsim\GD19754-PA 406 GD19754-PA 52..383 15..340 703 41.1 Plus
Dsim\GD21572-PA 956 GD21572-PA 52..381 33..358 627 40.2 Plus
Dsim\GD20496-PA 980 GD20496-PA 63..412 34..383 613 38.2 Plus
Dsim\GD23682-PA 572 GD23682-PA 16..325 36..340 403 33.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19773-PA 1741 GJ19773-PA 1..523 1..520 2098 84.5 Plus
Dvir\GJ19773-PA 1741 GJ19773-PA 1521..1741 519..703 773 80.1 Plus
Dvir\GJ11053-PA 4208 GJ11053-PA 71..386 29..340 732 42.6 Plus
Dvir\GJ12484-PA 973 GJ12484-PA 37..348 36..342 711 44.3 Plus
Dvir\GJ10735-PA 984 GJ10735-PA 58..407 34..383 610 37.9 Plus
Dvir\GJ24321-PA 1631 GJ24321-PA 4..244 35..274 530 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20669-PA 1742 GK20669-PA 1..529 1..520 2092 80.9 Plus
Dwil\GK20669-PA 1742 GK20669-PA 1519..1742 519..703 767 78.6 Plus
Dwil\GK13061-PA 972 GK13061-PA 39..350 36..342 706 43.9 Plus
Dwil\GK13240-PA 1056 GK13240-PA 48..379 15..340 692 40.8 Plus
Dwil\GK22759-PA 1306 GK22759-PA 5..313 54..358 623 41.5 Plus
Dwil\GK13341-PA 1006 GK13341-PA 61..405 34..376 603 38.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12026-PA 1746 GE12026-PA 1..520 1..520 2395 97.5 Plus
Dyak\GE12026-PA 1746 GE12026-PA 1527..1746 519..703 819 83.2 Plus
Dyak\GE25441-PA 4241 GE25441-PA 65..380 29..340 723 41.6 Plus
Dyak\GE10935-PA 1303 GE10935-PA 18..324 54..358 637 41.3 Plus
Dyak\GE24437-PA 982 GE24437-PA 63..413 34..384 608 37.8 Plus
Dyak\GE21082-PA 952 GE21082-PA 19..327 29..342 596 39.9 Plus

IP14940.hyp Sequence

Translation from 342 to 2453

> IP14940.hyp
MPAEIKPSAPAEPETPTKSKPKSSSSSHGKPALARVTLLDGSLLDVSIDR
KAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTD
TWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALL
GSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQ
SPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKL
RINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLW
KSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAESTNTPVDRTP
PKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSR
SPIKNKKEKLMRQSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQDAD
KEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAV
NGNDELNDSNKSDKSSGRRADATPTDLSGAYVTATAVTTRTATTHEDLGK
NAKTEQLEEKTVATTRTHDPNKQQQRVVTQEVKTTATVTSGDQKSPLFTT
SATTGPHVESTRVVLGEDTPGFSGHGEIISTQTVSSKTRTVETITYKTER
DGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQ
QTQ*

IP14940.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
cora-PC 703 CG11949-PC 1..703 1..703 3610 100 Plus
cora-PE 699 CG11949-PE 1..699 1..703 3333 90.2 Plus
cora-PB 889 CG11949-PB 1..603 1..589 2680 87.8 Plus
cora-PF 1600 CG11949-PF 1..491 1..519 2460 93.1 Plus
cora-PG 1696 CG11949-PG 1..481 1..519 2454 92.7 Plus
cora-PB 889 CG11949-PB 705..889 519..703 926 99.5 Plus
cora-PF 1600 CG11949-PF 1467..1600 567..703 564 84.7 Plus