Clone IP15253 Report

Search the DGRC for IP15253

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:152
Well:53
Vector:pOT2
Associated Gene/Transcriptbin-RA
Protein status:IP15253.pep: gold
Sequenced Size:2410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18647 2007-03-28 Manual selection by Ken Wan
bin 2008-04-29 Release 5.5 accounting
bin 2008-08-15 Release 5.9 accounting
bin 2008-12-18 5.12 accounting

Clone Sequence Records

IP15253.complete Sequence

2410 bp (2410 high quality bases) assembled on 2006-04-12

GenBank Submission: BT025075

> IP15253.complete
CCAAGCGGTGCGGTACTTTCAGTGGTTAAAGAAAATCCCACTCCGCCGGA
AAGAATTGCGCGTACTTTCGATTCGAAATTATAGTGAAAATTATTTCAAA
GAGAAATATTGATAAAAAAAAAACCAAAAATATTTTTAAAATATTTTTGA
AACAACGCACGGTGTTTGAAACCGAAAAGCCCAGTGAAAATGATTAAAAG
TGAAGAAGCCTCCGATCGTTCGGTTATGACCATGGATCAGCTGGGTGGCT
ACTACCACGATCCCCGCGCCCATCCCCCTTTCAGCCACCCACATGCACAC
TCCCACCCACATCAACACACCCACACTGGACATCCATATAGAGCTGGGAA
TCTGTTAACCGGTGGCAATTACCAGGCAATGGGTGGCGGAGAATCACCCA
CGGAGCTGATCGATGAGAAACCGAACATCGGGTATATGGAGCTAAAGCAT
TATATGGACGCTACGCCCACTGCCACGCCCGTTTCGGCAGCACAACATTA
TAGCCTAAGTGCGCTGCACAGCATGGGTACACCGCCGGCATCCTCCAGTC
CCATACCACCGTACGGGGTTCTAATGACTGCCCATTCGGCTGGATCCGCT
TCTCCGCAATCGAATTCGAAGACGCCCACGGATCTGCCGCAGGATTTGCA
GTATGCGAGCTCCAGCACATCAACCGCCAAGGTGCAGCCATTGCAGGTGC
AGCTGCAGCCACTCAACCATCAGTACGCGTCCACCATTAAGTACTGCTCC
AACAACACCATACTCAGTGCGAACGACTACCAATTGCTGACCAGCCAGGA
GCAGGCGGGGCAACAGCAGCCGCAGCAGTTGCCAGCCCAGCAGCTCCAGC
ATTCACCAGGCGGTGGCTACATGTCGCGCATTTCCACATCGCCGTCGCAG
GTGATCAGCAATGCGCACGGCATGCCCGTGCTAAACTACTCCAGCTCGAG
TTCCTCGCCTGCCAAGTCGCTCAACGGTTCCGAATCCTCGCCGCCCAGTC
AGAATCATCTGGAGAACAAGGTTTCGGGCTCAGCGGTGGTTGGTACAGGT
GGTTCCAGTCAGCAGGATGCGCCGAGCACTCCGGATACCACCAAGAAGTC
TGGTACCCGGCGGCCAGAGAAACCAGCACTCAGCTATATCAATATGATTG
GGCATGCGATCAAGGAATCACCAACTGGAAAGCTAACGCTCTCCGAGATC
TACGCCTACTTGCAGAAGAGCTACGAATTCTTTCGAGGACCCTACGTGGG
CTGGAAGAACTCGGTGCGCCACAATCTCAGCCTGAACGAGTGCTTCAAGA
AGCTGCCAAAGGGCATGGGCGTGGGCAAGCCGGGCAAGGGCAACTACTGG
ACCATTGACGAGAACTCGGCTCATCTCTTCGAGGACGAGGGCAGCCTGAG
GCGCCGGCCGCGTGGCTATCGCTCCAAGATCAAGGTGAAGCCGTATGCCG
GCCATGCCAATGGATACTACGCCAGCGGCTATGGCGATGCGGGAATGGAC
AATGGCAACTATTACGCCTCGCCTGCCTTTGCTAGCTACGATTACAGTGC
AGCTGGAGCCACTGGCGTCTCGCCGGCTGGTGGTCAAGGATTCGCCGATC
CCTGGAACGCCCATGCCGCCCACAGTGGCTCGTCGTCGGTGGGCGTGGGC
ATGGGCGTGGGTCCCCTGCCCCAGTATACGAACATATCCTGCCTGGCAGC
CGGAGGCAATGTGAATGGCTCGGCTACCACGCCCCCGCTGGCCCACTCCG
CACTGGGAATGGCCCCATCGGCATCATCCTCAAGTTCGCCACTGGGAGCG
GCGGCGACGCTTCAAAGCGATTATGCGCCAACCGCGAGTCTCGTGGCCGC
TGGCTATTCCTATGCAACAAGTGCCGGCAGCCTGGACAACGGCCTCCGTT
CGATTTCGCTGCAGCAGCTGCCCGGATTGTCCAGCATCCAGCATGCCCAG
GCTCAGGCCCAAGCACAGGCGCACCACCATCACCATCAGCACCATGCGAG
CCACCCCAGCCACAGCCATCAGGGCCACGGATCCATGCACCAGAATCACG
GCACATCATCCACGACGCCACCACCATCGCAGTCCGGTGGCAGCCATGGG
ATCGATCATTCGCCCATTGATCGCAAGCCGGCCTACCTGCCGCCCATCAG
CCCGCCCCCCATGATGGTGGCTCTGAATGGGGGCGGTGGATACTACGAGG
GACTCAAGTACGCCAACTAGCCATCCTCAACTTGGGATGGCGTGCATCAA
TATTACCTCAAAGGACACAATAATCACGTTTAATTAGGCTCTAAGTAGTG
GCACAGTAAAAGTAGTTGCATAGCGCATAGAAGGGAAACTATAATATACA
TGAATATAAATAGAAATAAACACAAATTATTTATAAAAAGACAAAAAAAA
AAAAAAAAAA

IP15253.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
bin-RA 2420 bin-RA 21..2415 1..2395 11975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6982907..6984128 1..1220 5820 98.6 Plus
chr3L 24539361 chr3L 6986209..6986710 1891..2392 2405 98.6 Plus
chr3L 24539361 chr3L 6985281..6985676 1497..1892 1920 99 Plus
chr3L 24539361 chr3L 6984932..6985211 1219..1498 1325 98.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
bin-RA 2031 CG18647-PA 1..2031 190..2220 10155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:24:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
bin-RA 2412 CG18647-RA 21..2412 1..2392 11960 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
bin-PA 676 CG18647-PA 1..676 190..2217 2417 100 Plus
fd64A-PB 365 CG1132-PB 86..217 1105..1509 217 36.7 Plus
fd64A-PA 365 CG1132-PA 86..217 1105..1509 217 36.7 Plus
croc-PA 508 CG5069-PA 70..169 1120..1428 200 45.6 Plus
slp1-PA 322 CG16738-PA 119..249 1117..1485 193 40.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6990642..6991861 1..1220 6100 100 Plus
3L 28110227 3L 6993946..6994450 1891..2395 2525 100 Plus
3L 28110227 3L 6993023..6993418 1497..1892 1980 100 Plus
3L 28110227 3L 6992674..6992953 1219..1498 1400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6983742..6984961 1..1220 6100 100 Plus
3L 28103327 3L 6987046..6987550 1891..2395 2525 100 Plus
3L 28103327 3L 6986123..6986518 1497..1892 1980 100 Plus
3L 28103327 3L 6985774..6986053 1219..1498 1400 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:41:49 has no hits.

IP15253.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:53:40 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6986210..6986710 1892..2392 98   Plus
chr3L 6985282..6985675 1498..1891 98 -> Plus
chr3L 6984934..6985210 1221..1497 98 -> Plus
chr3L 6982907..6984128 1..1220 95 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:58:48 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 1..2031 190..2220 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:51:33 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 1..2031 190..2220 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:52:49 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 1..2031 190..2220 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:32:14 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 1..2031 190..2220 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:40 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 1..2031 190..2220 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:25:34 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 21..2409 1..2389 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:51:33 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 21..2409 1..2389 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:52:49 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 21..2412 1..2392 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:32:14 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 21..2409 1..2389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:40 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 21..2412 1..2392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:53:40 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6993947..6994447 1892..2392 100   Plus
3L 6993024..6993417 1498..1891 100 -> Plus
3L 6992676..6992952 1221..1497 100 -> Plus
3L 6990642..6991861 1..1220 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:52:49 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6987047..6987547 1892..2392 100   Plus
arm_3L 6986124..6986517 1498..1891 100 -> Plus
arm_3L 6985776..6986052 1221..1497 100 -> Plus
arm_3L 6983742..6984961 1..1220 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:10:46 Download gff for IP15253.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6987047..6987547 1892..2392 100   Plus
3L 6986124..6986517 1498..1891 100 -> Plus
3L 6985776..6986052 1221..1497 100 -> Plus
3L 6983742..6984961 1..1220 100 -> Plus

IP15253.pep Sequence

Translation from 189 to 2219

> IP15253.pep
MIKSEEASDRSVMTMDQLGGYYHDPRAHPPFSHPHAHSHPHQHTHTGHPY
RAGNLLTGGNYQAMGGGESPTELIDEKPNIGYMELKHYMDATPTATPVSA
AQHYSLSALHSMGTPPASSSPIPPYGVLMTAHSAGSASPQSNSKTPTDLP
QDLQYASSSTSTAKVQPLQVQLQPLNHQYASTIKYCSNNTILSANDYQLL
TSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNY
SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDT
TKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRG
PYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDE
GSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAFASY
DYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNIS
CLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTAS
LVAAGYSYATSAGSLDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQ
HHASHPSHSHQGHGSMHQNHGTSSTTPPPSQSGGSHGIDHSPIDRKPAYL
PPISPPPMMVALNGGGGYYEGLKYAN*

IP15253.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23557-PA 661 GF23557-PA 1..661 1..676 2246 74.2 Plus
Dana\GF16437-PA 491 GF16437-PA 173..286 288..408 262 43 Plus
Dana\GF13549-PA 456 GF13549-PA 78..177 311..412 253 45.1 Plus
Dana\GF15038-PA 350 GF15038-PA 130..235 310..414 248 44.4 Plus
Dana\GF25022-PA 371 GF25022-PA 85..182 305..398 245 43.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14397-PA 688 GG14397-PA 1..688 1..676 2644 88 Plus
Dere\GG12065-PA 511 GG12065-PA 193..306 288..408 261 43 Plus
Dere\GG22808-PA 454 GG22808-PA 85..184 311..412 251 45.1 Plus
Dere\GG24971-PA 323 GG24971-PA 66..243 251..432 249 35.1 Plus
Dere\GG15176-PA 364 GG15176-PA 88..182 308..398 244 44.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15374-PA 665 GH15374-PA 72..665 46..674 1606 64.3 Plus
Dgri\GH23238-PA 311 GH23238-PA 1..311 344..674 986 67 Plus
Dgri\GH18716-PA 492 GH18716-PA 163..283 295..408 263 39.8 Plus
Dgri\GH21797-PA 456 GH21797-PA 79..178 311..412 254 45.1 Plus
Dgri\GH11193-PA 340 GH11193-PA 110..248 295..432 249 39 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
bin-PA 676 CG18647-PA 1..676 1..676 3605 100 Plus
fkh-PD 510 CG10002-PD 3..305 86..408 274 29.1 Plus
fkh-PB 510 CG10002-PB 3..305 86..408 274 29.1 Plus
fkh-PA 510 CG10002-PA 3..305 86..408 274 29.1 Plus
fkh-PE 518 CG10002-PE 3..305 86..408 274 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12976-PA 639 GI12976-PA 1..639 1..676 1700 64.6 Plus
Dmoj\GI22864-PA 501 GI22864-PA 173..293 295..408 262 39.8 Plus
Dmoj\GI20546-PA 481 GI20546-PA 94..193 311..412 255 45.1 Plus
Dmoj\GI18113-PA 342 GI18113-PA 117..228 304..414 252 43 Plus
Dmoj\GI12553-PA 349 GI12553-PA 76..170 308..398 245 44.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15052-PA 656 GL15052-PA 1..656 1..676 1732 61.7 Plus
Dper\GL23472-PA 586 GL23472-PA 163..276 288..408 259 43 Plus
Dper\GL10130-PA 457 GL10130-PA 73..172 311..412 254 45.1 Plus
Dper\GL16060-PA 369 GL16060-PA 72..169 305..398 250 43.9 Plus
Dper\GL18682-PA 342 GL18682-PA 131..264 310..436 250 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29323-PA 652 GA29323-PA 1..603 1..583 1668 65 Plus
Dpse\GA10002-PB 481 GA10002-PB 163..276 288..408 261 43 Plus
Dpse\GA17601-PA 457 GA17601-PA 73..172 311..412 254 45.1 Plus
Dpse\GA10915-PA 377 GA10915-PA 80..177 305..398 251 43.9 Plus
Dpse\GA14117-PA 347 GA14117-PA 136..269 310..436 249 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14811-PA 680 GM14811-PA 1..680 1..676 2846 94.9 Plus
Dsec\GM16286-PA 505 GM16286-PA 187..300 288..408 261 43 Plus
Dsec\GM15965-PA 456 GM15965-PA 85..184 311..412 252 45.1 Plus
Dsec\GM18442-PA 322 GM18442-PA 65..242 251..432 251 35.1 Plus
Dsec\GM14607-PA 368 GM14607-PA 88..182 308..398 243 44.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13983-PA 680 GD13983-PA 1..680 1..676 2875 95.7 Plus
Dsim\GD18028-PA 510 GD18028-PA 192..305 288..408 261 43 Plus
Dsim\GD11717-PA 456 GD11717-PA 85..184 311..412 252 45.1 Plus
Dsim\GD23260-PA 322 GD23260-PA 65..242 251..432 251 35.1 Plus
Dsim\GD13797-PA 368 GD13797-PA 88..182 308..398 243 44.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13121-PA 651 GJ13121-PA 48..651 50..676 1776 65 Plus
Dvir\fkh-PA 502 GJ14162-PA 187..293 298..408 261 44.1 Plus
Dvir\GJ22399-PA 471 GJ22399-PA 85..184 311..412 254 45.1 Plus
Dvir\GJ15456-PA 348 GJ15456-PA 82..176 308..398 245 44.2 Plus
Dvir\GJ16300-PA 343 GJ16300-PA 121..232 304..414 240 42.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16994-PA 686 GK16994-PA 1..686 1..676 1648 58.5 Plus
Dwil\GK10997-PA 652 GK10997-PA 161..274 288..408 261 43 Plus
Dwil\GK20787-PA 467 GK20787-PA 79..178 311..412 254 45.1 Plus
Dwil\GK15483-PA 346 GK15483-PA 139..259 310..434 247 40.6 Plus
Dwil\GK16995-PA 528 GK16995-PA 70..169 311..413 239 46.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21586-PA 699 GE21586-PA 1..699 1..676 2591 86.3 Plus
Dyak\GE10507-PA 509 GE10507-PA 191..304 288..408 261 43 Plus
Dyak\GE14241-PA 454 GE14241-PA 85..184 311..412 251 45.1 Plus
Dyak\GE18262-PA 324 GE18262-PA 120..243 310..432 249 42.1 Plus
Dyak\GE21395-PA 362 GE21395-PA 88..182 308..398 244 44.2 Plus

IP15253.hyp Sequence

Translation from 189 to 2219

> IP15253.hyp
MIKSEEASDRSVMTMDQLGGYYHDPRAHPPFSHPHAHSHPHQHTHTGHPY
RAGNLLTGGNYQAMGGGESPTELIDEKPNIGYMELKHYMDATPTATPVSA
AQHYSLSALHSMGTPPASSSPIPPYGVLMTAHSAGSASPQSNSKTPTDLP
QDLQYASSSTSTAKVQPLQVQLQPLNHQYASTIKYCSNNTILSANDYQLL
TSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNY
SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDT
TKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRG
PYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDE
GSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAFASY
DYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNIS
CLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTAS
LVAAGYSYATSAGSLDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQ
HHASHPSHSHQGHGSMHQNHGTSSTTPPPSQSGGSHGIDHSPIDRKPAYL
PPISPPPMMVALNGGGGYYEGLKYAN*

IP15253.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
bin-PA 676 CG18647-PA 1..676 1..676 3605 100 Plus
fkh-PD 510 CG10002-PD 3..305 86..408 274 29.1 Plus
fkh-PB 510 CG10002-PB 3..305 86..408 274 29.1 Plus
fkh-PA 510 CG10002-PA 3..305 86..408 274 29.1 Plus
fkh-PE 518 CG10002-PE 3..305 86..408 274 29.1 Plus