Clone IP15590 Report

Search the DGRC for IP15590

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:155
Well:90
Vector:pOT2
Associated Gene/TranscriptAtg16-RC
Protein status:IP15590.pep: gold
Sequenced Size:2317

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31033 2008-04-29 Release 5.5 accounting
CG31033 2008-08-15 Release 5.9 accounting
CG31033 2008-12-18 5.12 accounting

Clone Sequence Records

IP15590.complete Sequence

2317 bp (2317 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024267

> IP15590.complete
AACAACAATAATCATATTTGGTTAAAAACAATTATGCGAATAAACGCAGC
CGCCTTATAGCGCCCGTGCCACACCCCCTGCGATGCGAACAGGCGACCAC
GCCAAGGTGTCGCCACGAATCCTGCAAGCAAGGAGAACCCAAGCCAAGAG
TCCGGAGTCCCCAGTACGGAGCACCCAGAAATTCCGGGCAGAAACCCAAT
AAAAACATGTCTACGGAGGAGCATGTGTGGCGAGCGCACGTCGTGCGGCG
CTTACGCGAGCGAAATCGCAAGGAGTGCGACAACTTCAAGGAGATCATCG
AGCAAAACAACCGACTGATTGACCATGTGGCGCAACTGAAGGCGGACAAC
CTGAAGATCTCCGTCGAAAACGAGCAGCTCCGCAACGCGGTGTCAACAGG
TGGCACCGGCTCCAACGTGGCTATCGCCACCCTCGAAAAGAAGCTGCTCA
GCCAGCAGGAGGAGCTCACAGAGCTACACAAGCGCAAGGGCGAGAACTCC
CAGATGATCGTGGACCTCAACCAGAAGGTCGAGCAGCAGAGGATCATAAT
TTCCGAGAAGGAGCACAGCCTCGTCGAACAGCAAACGAACAACAACCGAT
TGCGCGCGGAGGTGCAGCTACTTCACTCGAGTTTGGAGGAACTCAAGAAG
CTGAACAACACAATGCTGGACGAACATACGGCGCTTCAATTGGCATTTAG
CTCCCTCGAGGAGAAGTTAAGGGGAGTGCAAGATGAAAATCGGCGTCTAC
TGGAGCGACTTATGCAATACAAGTCAAAGGATGCCGACAAGTTGAACGAG
GAAAACGAGAGCATAATTAGGAAACGTTCGGCTAAACTGAAACGTGACCT
AGAAGACGCGGTTCGTGAGCCCAGTTCGTCCAGCAACGCCGCCTCCTCGC
CCGGCGCCGCATCCTTGCAGCGCAACTCCAGTCCCGCCCAGTTCGTTGGC
GGCCTCATCGGCGACGAGGATTTCGACGAGGCTGCGATAAATGGCGCCAT
GGAGGCCATAGGTCTCGATGATAATGAATATATTAGCGCTCGTTTTACAG
CAGGCGAAATCGCCGAGAACTCGCGGGCTTCCATCGACACCCTGAAGGCC
ACGGGCTACCTGGGCCAGGCCAATCCCACCAAGATCCTCATGAAGTTCGA
GGCCCACGAGAACGAGTCGCACGCGGTGCGCTGGAGTCCCGTGGAGCGCA
TGGTGGCCACCGGTGGCGCTGATCGCAAAGTCAAACTTTGGGACATTGGC
AAAAATTCCACCGAACCACGTGCCGTTCTAAGCGGGAGCAGTGCTGGGAT
TAACTCCGTAGATTTCGATTCGACAGGCGCCTACATCCTGGGCACCTCCA
ATGACTACGGAGCCAGAGTATGGACAGTGATGGACAATCGCTTAAGACAC
ACGCTGACGGGTCACAGCGGCAAGGTAATGGCCGCCAAGTACGTCCAGGA
GCCCATCAAAGTGGTGACCGGTAGCCACGATCGCACACTGAAGATCTGGG
ATTTGCGCAGCATCGCCTGCATAGAGACGAAGTTCGCCGGCTCCAGCTGC
AATGATCTAGTCACCACCGACAGCCTCGGATCAACGATCATCAGTGGGCA
CTACGATAAGAAGATCCGGTTCTGGGACATACGCACCGAGAAGCAGGCGG
ACGACGTCTTAATGCCGGCCAAGATCACCTCTTTGGATTTGTCAAAAGAT
TGCAATTACCTCATATGCTCTGTAAGAGACGATACTATTAAACTGTTAGA
TTTACGCAAGAACCAAGTTATATCCACGTTTACAAACGAACACTTTAAGA
TCAGCTGTGATTTTGCTCGAGCTTCTTTCAACTCGAGCGGCCTGAAGATC
GCTTGTGGATCAGCGGATGGCGCTATATACATTTGGAATGTGAATGGGTT
CCTGGAAGCCACACTCAAGGGACACAGCACCGCCGTAAACGCGGTCAGTT
GGAGTCCCAACAACAACATGCTGGCCTCCGTGGGAAAGAACAAGCGCTGC
ACCATCTACTCGGAGTCATAGCCCTAATGTTGCCATACACGTCACTCGAG
CCAGTCGGATGCAATCCAATTCCGAAACTGAAACGCTTAAGAAGTCAGAG
CAGTGCTGCAATCTGCTGTACATAGTAAATTCGGTCGACGTTTTAACAAC
TTTACTTGATTATTTTATTTATACGTGAATCGGATATAGTATGCAAATTG
TATCAATTCATATAGTGTTAGTCTAAGTACATGTTTTCCTATTGTAAAAA
AAAATAAACACACATGCGCATATTGGGTTGCATATACGAGCAATCTAAGC
AAAAAAAAAAAAAAAAA

IP15590.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31033-RC 2420 CG31033-RC 108..2410 1..2303 11485 99.9 Plus
CG31033-RA 1663 CG31033-RA 91..1662 732..2303 7830 99.8 Plus
CG31033.a 2388 CG31033.a 894..2378 819..2303 7395 99.8 Plus
CG31033.a 2388 CG31033.a 52..875 1..824 4105 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25654445..25654880 1254..819 2120 99.1 Minus
chr3R 27901430 chr3R 25649819..25650196 2300..1924 1840 99.7 Minus
chr3R 27901430 chr3R 25657271..25657576 306..1 1515 99.7 Minus
chr3R 27901430 chr3R 25650766..25651066 1698..1398 1490 99.7 Minus
chr3R 27901430 chr3R 25656886..25657147 568..307 1295 99.6 Minus
chr3R 27901430 chr3R 25656457..25656622 732..567 830 100 Minus
chr3R 27901430 chr3R 25650389..25650532 1927..1784 720 100 Minus
chr3R 27901430 chr3R 25654220..25654362 1397..1255 715 100 Minus
chr3R 27901430 chr3R 25655719..25655808 821..732 450 100 Minus
chr3R 27901430 chr3R 25650613..25650699 1783..1697 435 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-RC 1815 CG31033-PC 1..1815 207..2021 9045 99.9 Plus
Atg16-RB 1338 CG31033-PB 49..1338 732..2021 6420 99.8 Plus
Atg16-RA 1260 CG31033-PA 1..1260 762..2021 6270 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:25:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-RC 2350 CG31033-RC 51..2350 1..2300 11470 99.9 Plus
Atg16-RB 1668 CG31033-RB 100..1668 732..2300 7815 99.9 Plus
Atg16-RA 1659 CG31033-RA 91..1659 732..2300 7815 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-PC 604 CG31033-PC 1..604 207..2018 2838 100 Plus
Atg16-PF 612 CG31033-PF 1..612 207..2018 2819 98.7 Plus
Atg16-PB 445 CG31033-PB 16..445 729..2018 2133 100 Plus
Atg16-PA 419 CG31033-PA 1..419 762..2018 2079 100 Plus
wds-PB 361 CG17437-PB 71..354 1155..2006 323 29.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29831915..29832350 1254..819 2165 99.8 Minus
3R 32079331 3R 29827278..29827657 2303..1924 1900 100 Minus
3R 32079331 3R 29834746..29835051 306..1 1530 100 Minus
3R 32079331 3R 29828226..29828526 1698..1398 1505 100 Minus
3R 32079331 3R 29834361..29834622 568..307 1310 100 Minus
3R 32079331 3R 29833932..29834097 732..567 830 100 Minus
3R 32079331 3R 29831690..29831832 1397..1255 715 100 Minus
3R 32079331 3R 29827850..29827993 1927..1784 705 99.3 Minus
3R 32079331 3R 29833192..29833281 821..732 450 100 Minus
3R 32079331 3R 29828073..29828159 1783..1697 435 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29572746..29573181 1254..819 2165 99.7 Minus
3R 31820162 3R 29568109..29568488 2303..1924 1900 100 Minus
3R 31820162 3R 29575577..29575882 306..1 1530 100 Minus
3R 31820162 3R 29569057..29569357 1698..1398 1505 100 Minus
3R 31820162 3R 29575192..29575453 568..307 1310 100 Minus
3R 31820162 3R 29574763..29574928 732..567 830 100 Minus
3R 31820162 3R 29572521..29572663 1397..1255 715 100 Minus
3R 31820162 3R 29568681..29568824 1927..1784 705 99.3 Minus
3R 31820162 3R 29574023..29574112 821..732 450 100 Minus
3R 31820162 3R 29568904..29568990 1783..1697 435 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:21:49 has no hits.

IP15590.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:24:08 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25657271..25657576 1..306 99   Minus
chr3R 25656886..25657147 307..568 99 <- Minus
chr3R 25656458..25656620 569..731 100 <- Minus
chr3R 25655720..25655808 732..820 100 <- Minus
chr3R 25654445..25654878 821..1254 99 <- Minus
chr3R 25654220..25654362 1255..1397 100 <- Minus
chr3R 25650766..25651066 1398..1698 99 <- Minus
chr3R 25650613..25650697 1699..1783 100 <- Minus
chr3R 25650389..25650532 1784..1927 100 <- Minus
chr3R 25649819..25650192 1928..2300 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:59:36 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 1..1815 207..2021 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:50 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 1..1815 207..2021 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:56:59 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 1..1815 207..2021 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:09:09 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 1..1815 207..2021 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:08 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 1..1815 207..2021 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:06:07 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 51..2350 1..2300 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:49 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 51..2350 1..2300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:56:59 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 51..2350 1..2300 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:09:09 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 51..2350 1..2300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:08 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 51..2350 1..2300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:24:08 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29834746..29835051 1..306 100   Minus
3R 29834361..29834622 307..568 100 <- Minus
3R 29833933..29834095 569..731 100 <- Minus
3R 29833193..29833281 732..820 100 <- Minus
3R 29831915..29832348 821..1254 99 <- Minus
3R 29831690..29831832 1255..1397 100 <- Minus
3R 29828226..29828526 1398..1698 100 <- Minus
3R 29828073..29828157 1699..1783 100 <- Minus
3R 29827850..29827993 1784..1927 99 <- Minus
3R 29827281..29827653 1928..2300 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:56:59 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25660468..25660773 1..306 100   Minus
arm_3R 25660083..25660344 307..568 100 <- Minus
arm_3R 25659655..25659817 569..731 100 <- Minus
arm_3R 25658915..25659003 732..820 100 <- Minus
arm_3R 25657637..25658070 821..1254 99 <- Minus
arm_3R 25657412..25657554 1255..1397 100 <- Minus
arm_3R 25653948..25654248 1398..1698 100 <- Minus
arm_3R 25653795..25653879 1699..1783 100 <- Minus
arm_3R 25653572..25653715 1784..1927 99 <- Minus
arm_3R 25653003..25653375 1928..2300 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:46 Download gff for IP15590.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29575577..29575882 1..306 100   Minus
3R 29575192..29575453 307..568 100 <- Minus
3R 29574764..29574926 569..731 100 <- Minus
3R 29574024..29574112 732..820 100 <- Minus
3R 29572746..29573179 821..1254 99 <- Minus
3R 29572521..29572663 1255..1397 100 <- Minus
3R 29569057..29569357 1398..1698 100 <- Minus
3R 29568904..29568988 1699..1783 100 <- Minus
3R 29568681..29568824 1784..1927 99 <- Minus
3R 29568112..29568484 1928..2300 100 <- Minus

IP15590.pep Sequence

Translation from 206 to 2020

> IP15590.pep
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLK
ISVENEQLRNAVSTGGTGSNVAIATLEKKLLSQQEELTELHKRKGENSQM
IVDLNQKVEQQRIIISEKEHSLVEQQTNNNRLRAEVQLLHSSLEELKKLN
NTMLDEHTALQLAFSSLEEKLRGVQDENRRLLERLMQYKSKDADKLNEEN
ESIIRKRSAKLKRDLEDAVREPSSSSNAASSPGAASLQRNSSPAQFVGGL
IGDEDFDEAAINGAMEAIGLDDNEYISARFTAGEIAENSRASIDTLKATG
YLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKN
STEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTL
TGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCND
LVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCN
YLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIAC
GSADGAIYIWNVNGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTI
YSES*

IP15590.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 00:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16323-PA 606 GF16323-PA 1..606 1..604 3044 93.9 Plus
Dana\GF20700-PA 347 GF20700-PA 48..341 311..601 313 26.5 Plus
Dana\GF13988-PA 579 GF13988-PA 295..565 323..593 304 29.7 Plus
Dana\GF22217-PA 361 GF22217-PA 64..345 312..591 298 29.6 Plus
Dana\GF11669-PA 362 GF11669-PA 20..316 253..562 227 24.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 00:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11997-PA 603 GG11997-PA 1..603 1..604 3124 98.7 Plus
Dere\GG24701-PA 347 GG24701-PA 48..341 311..601 305 27.5 Plus
Dere\GG12938-PA 361 GG12938-PA 64..345 312..591 298 29.6 Plus
Dere\GG13777-PA 390 GG13777-PA 54..300 312..563 234 25.3 Plus
Dere\GG19338-PA 818 GG19338-PA 2..254 305..555 206 28.2 Plus
Dere\GG13777-PA 390 GG13777-PA 7..213 393..601 158 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 00:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22420-PA 613 GH22420-PA 1..613 1..604 2743 84.2 Plus
Dgri\GH11537-PA 347 GH11537-PA 48..341 311..601 309 27.6 Plus
Dgri\GH24921-PA 357 GH24921-PA 60..341 312..591 300 29.6 Plus
Dgri\GH25232-PA 247 GH25232-PA 56..241 419..601 217 30.7 Plus
Dgri\GH14795-PA 404 GH14795-PA 38..301 295..563 211 23.7 Plus
Dgri\GH25232-PA 247 GH25232-PA 24..207 302..479 150 26.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-PC 604 CG31033-PC 1..604 1..604 3073 100 Plus
Atg16-PF 612 CG31033-PF 1..612 1..604 3054 98.7 Plus
Atg16-PB 445 CG31033-PB 16..445 175..604 2210 100 Plus
Atg16-PA 419 CG31033-PA 1..419 186..604 2156 100 Plus
wds-PB 361 CG17437-PB 71..354 317..600 323 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 00:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20554-PA 610 GI20554-PA 1..610 1..604 2803 86.1 Plus
Dmoj\GI21774-PA 358 GI21774-PA 61..342 312..591 298 29.6 Plus
Dmoj\GI17028-PA 347 GI17028-PA 48..341 311..601 297 26.6 Plus
Dmoj\GI11850-PA 402 GI11850-PA 51..297 312..563 239 27.3 Plus
Dmoj\GI19111-PA 373 GI19111-PA 73..350 314..591 234 22.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 00:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24002-PA 598 GL24002-PA 1..598 1..604 2852 88.7 Plus
Dper\GL13093-PA 356 GL13093-PA 59..340 312..591 298 29.3 Plus
Dper\GL18847-PA 347 GL18847-PA 48..341 311..601 289 24.5 Plus
Dper\GL21559-PA 413 GL21559-PA 29..300 287..563 239 25.1 Plus
Dper\GL25365-PA 413 GL25365-PA 29..300 287..563 238 25.1 Plus
Dper\GL21559-PA 413 GL21559-PA 7..213 393..601 163 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 00:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15952-PA 598 GA15952-PA 1..598 1..604 2854 88.8 Plus
Dpse\GA15952-PB 410 GA15952-PB 1..410 186..604 2008 90.5 Plus
Dpse\GA14510-PA 356 GA14510-PA 59..340 312..591 298 29.3 Plus
Dpse\GA17451-PA 347 GA17451-PA 48..341 311..601 289 24.5 Plus
Dpse\GA10144-PA 413 GA10144-PA 29..300 287..563 234 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 00:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12216-PA 574 GM12216-PA 1..574 1..604 2849 92.3 Plus
Dsec\GM16719-PA 347 GM16719-PA 48..341 311..601 301 27.5 Plus
Dsec\GM19230-PA 361 GM19230-PA 64..345 312..591 299 29.6 Plus
Dsec\GM24599-PA 389 GM24599-PA 29..300 287..563 239 25.2 Plus
Dsec\GM13994-PA 1325 GM13994-PA 1003..1193 373..573 196 28.8 Plus
Dsec\GM24599-PA 389 GM24599-PA 7..213 393..601 156 23.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 00:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17638-PA 597 GD17638-PA 1..597 1..604 2541 84.6 Plus
Dsim\GD23005-PA 347 GD23005-PA 48..341 311..601 301 27.5 Plus
Dsim\GD16610-PA 361 GD16610-PA 64..345 312..591 299 29.6 Plus
Dsim\GD12669-PA 389 GD12669-PA 29..300 287..563 234 24.8 Plus
Dsim\GD23532-PA 317 GD23532-PA 14..305 309..595 189 25.6 Plus
Dsim\GD12669-PA 389 GD12669-PA 7..213 393..601 153 23 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 00:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22407-PA 610 GJ22407-PA 1..610 1..604 2806 86.1 Plus
Dvir\GJ16947-PA 358 GJ16947-PA 61..342 312..591 298 29.6 Plus
Dvir\GJ24581-PA 347 GJ24581-PA 48..341 311..601 293 26.6 Plus
Dvir\GJ22241-PA 373 GJ22241-PA 73..350 314..591 239 24 Plus
Dvir\GJ13548-PA 405 GJ13548-PA 51..297 312..563 216 25.2 Plus
Dvir\GJ22241-PA 373 GJ22241-PA 68..274 353..561 159 22.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 00:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11448-PA 664 GK11448-PA 1..600 1..592 2845 90.2 Plus
Dwil\GK19997-PA 358 GK19997-PA 61..342 312..591 298 29.6 Plus
Dwil\GK23911-PA 347 GK23911-PA 33..341 296..601 297 25.9 Plus
Dwil\GK19416-PA 346 GK19416-PA 42..300 307..562 227 25.8 Plus
Dwil\GK10412-PA 414 GK10412-PA 54..300 312..563 223 26.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 00:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10422-PA 605 GE10422-PA 1..605 1..604 3159 99.3 Plus
Dyak\GE16626-PA 347 GE16626-PA 48..341 311..601 302 27.5 Plus
Dyak\GE16263-PA 361 GE16263-PA 64..345 312..591 298 29.6 Plus
Dyak\GE20071-PA 391 GE20071-PA 54..300 312..563 234 25.7 Plus
Dyak\GE15982-PA 817 GE15982-PA 2..254 305..555 207 28.2 Plus
Dyak\GE20071-PA 391 GE20071-PA 7..213 393..601 158 24.3 Plus

IP15590.hyp Sequence

Translation from 206 to 2020

> IP15590.hyp
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLK
ISVENEQLRNAVSTGGTGSNVAIATLEKKLLSQQEELTELHKRKGENSQM
IVDLNQKVEQQRIIISEKEHSLVEQQTNNNRLRAEVQLLHSSLEELKKLN
NTMLDEHTALQLAFSSLEEKLRGVQDENRRLLERLMQYKSKDADKLNEEN
ESIIRKRSAKLKRDLEDAVREPSSSSNAASSPGAASLQRNSSPAQFVGGL
IGDEDFDEAAINGAMEAIGLDDNEYISARFTAGEIAENSRASIDTLKATG
YLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKN
STEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTL
TGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCND
LVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCN
YLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIAC
GSADGAIYIWNVNGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTI
YSES*

IP15590.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-PC 604 CG31033-PC 1..604 1..604 3073 100 Plus
Atg16-PF 612 CG31033-PF 1..612 1..604 3054 98.7 Plus
Atg16-PB 445 CG31033-PB 16..445 175..604 2210 100 Plus
Atg16-PA 419 CG31033-PA 1..419 186..604 2156 100 Plus
wds-PB 361 CG17437-PB 71..354 317..600 323 29.4 Plus