Clone IP18173 Report

Search the DGRC for IP18173

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:181
Well:73
Vector:pOT2
Associated Gene/TranscriptCG2023-RA
Protein status:IP18173.pep: gold
Sequenced Size:2400

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2023 2008-04-29 Release 5.5 accounting
CG2023 2008-08-15 Release 5.9 accounting
CG2023 2008-12-18 5.12 accounting

Clone Sequence Records

IP18173.complete Sequence

2400 bp assembled on 2007-07-31

GenBank Submission: BT030855

> IP18173.complete
CAAAACAAAGTTGGAGACATGGACAAGGATGCGTTTACATTACAGGCCAT
ACGGCAGGACCTTATCGATAACAATCTGCAGGCTAAGGCAATAATACACG
ACATCCTGAACAGCCGCACCTCCATCGCCGAACTCGAGGAGCTGAACGAA
GCGGGCCGCTCCAAACTGTCTGCTATCCGCAAAAGCATCGAGCGGCTGGA
CGACTGGGCGCGGGACACGGCAGACTCTGCGCTGGCCAATGAAGTGGACG
ACCACCGTGATCAGTTCTCCAAAACGCTGCAGGCGTTCCGAAAAGCAAAC
GTGTCCACGATGCTGGAGATCGAGAAGGCCAATCGGGAGGAGTTAATGGC
CATTACCGGCGAGAGTGAGCTACGCCAACGAACCACAACACGGGCGCGGC
ACAACCAGGGCAGTCTGGTTTCGCAGGAGAACGACGTGACCGAGAAGATG
CTGGCTATATCGCGGCACCTCTCGGAGACCACCCAGAAGAGCGCCATCAC
CCTGGAAACGCTCGTGGCCTCGTCGCAAAATGTGGAGGCCACCAGCGACG
AACTGCACCACACGGCCGGCAGCATTAGCATGTCCGGCAAGCTGCTCAAA
AAGTACGGACGACGCGAGTGCACTGACAAAATGCTGCTCTTCTTCGCCTT
CTCCTTGTTCCTCGCCTGTGTCTTTTACATCGTCCAAAAGCGACTCTTCT
AAGACTCCACAAATGGACAAAACCCGTTCCCAAAATAGCTTAAGGTTGTC
GCTTCTGTTGTCTAGGTATAGCTAGATTAAGCTTAGCACATGACCATACC
TTGTAAGCACAGCTCCTATATTTATATTATTTAGTGATTTGCCTAAGTTG
TAAACGTGGTACAGCCAAGGACCCTAGAGTAGCAAGATGCGTAACGCCAT
ACGATTTTTTGGCACACGATTTTTTGGCCGTGGCTCTAGAGGTGGCTCCA
GGCTCTCTCGAATTTTTGTTAGAGAGCGAGAGAGCGAAGAGCGCTACAGC
GAACAGCTCTTTTCAACGCACAAAGTGATAGCAGACATCTGTATGTGTGC
ACACGTATTCACATGCATTGTAAATTTGACAAAATATGCCCTTCACCTTA
GAAGTTTTTTGGCTTTAAATTTATATTATTTTTATCAATTGGCACCTTGC
GAAAAATTCTTGTTTTGCATTGCCTTAACGTTATTATATTTGAAAATAGA
TTAGAAATAGTCAAATCTATGTACATATTATCACAAAAATAAATTTCAAA
AATGAATTTATATAAGAATATTTGTCATTAGAGTATTCATCTTGCGGCGT
GTGAAAAATTAATAAGGCAATGATTGTTGAGTGCTTGTGTCCGCACTTCG
TGCCTCAAGATATGAACAAAGCAAAGACACTAGAATAATTCTATTGTCTT
TGATATTACTTTTGCAATTTAATTTAATTGCATATTTAATTATTTAGTAT
ATTTATTAAATCATTTGACTTAATATGATGTAACATTAACATTAAAAGTG
TTTCAAAAAAAATATTTCGGTTTTAAAAAATTGTCAGATGAGAGACAAAT
TAGAATTAAACATAAATACAAATGTGTAAACGGTAGCTAATTCGAGCGGC
GATTTTAACAAAGAAATTTAAAAAAGCTTTAAAATTATAATAGCCAGGGC
GCGAATTTTTAAAAATTTTTTATTTTATCATATTGCTAGGAAATTGGCAA
AAACTACCCTAATATGTACCATGTAAATTCGTTTTTTCGATCAGAATTGA
TTTCGGCCCGAAAATCGTCTTCTAGCACAACACGCACACTTATACGCGTT
CTCGTCTCTTGTTTTTACTCACACAAGCAAGCAAATTATATTTTTAGATT
TCTTACGCTCTAAGCGGGAGTGAGCGGAAAGAGAGTAATTTTGGCCGTCA
CCAAAAAAGTGGCTGCATAGTGCCAAACCAATGTATGGCCGTTGCGCATC
TTGTTGTTCTAGTGTCTTTGGTACAGCCTAGTATAGTATGGTAAATGCAA
TTTATTTTTATTTAGAATATATGAGTGTTGTATATGTAGATAAAAATGTT
AAGCAAGTTAGTAAGGGCACCTAGGCACTCCTCCGGGGTTTGTGAATCCG
TTGGTGTTGACCAACCTGCAGATGTCCTTGTATGACCGCGCCGATTTTGC
AGGCCTTTCTGGCTGTGGCTGGGAATAACCTCTGTTGTAATAGTCAGGAT
AGAACTGGAACCAAGAAGGCCTGTGGTAGTTGTAGTCGGGAAAAAATTCT
TTAAGCACAGAGCTGCTGCAGAATCTGCTTAGCCCCAGAATCCACAGCAG
AATGTATATAATCGACTTGCGCATGGCCACTTCGCCTGAGCTTAAGATTT
GGAATAAAGCCGTACCCGATTCTCATTGTAAAAAAAAAAAAAAAAAAAAA

IP18173.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023.a 1082 CG2023.a 146..1082 1..937 4640 99.6 Plus
Kif3C-RA 4376 Kif3C-RA 2908..3457 865..1418 2080 92.8 Plus
Kif3C-RA 4376 Kif3C-RA 3556..4041 1486..1971 1965 94.2 Plus
Hcf-RC 7223 Hcf-RC 6662..6840 1211..1032 520 88.4 Minus
Hcf-RC 7223 Hcf-RC 6513..6642 1365..1236 470 90.7 Minus
Hcf-RC 7223 Hcf-RC 6305..6405 1970..1872 360 92 Minus
Hcf-RC 7223 Hcf-RC 6914..6969 944..889 235 94.6 Minus
Hcf-RC 7223 Hcf-RC 6855..6915 1027..967 215 90.1 Minus
Kif3C-RA 4376 Kif3C-RA 3526..3557 1435..1466 145 96.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1647672..1649953 2379..100 11175 99.5 Minus
chr2R 21145070 chr2R 1148582..1149691 1972..865 5240 98.6 Minus
chr3R 27901430 chr3R 8296460..8297570 1972..864 5215 98.4 Minus
chr3L 24539361 chr3L 21488296..21489403 866..1971 5015 97.7 Plus
chr3R 27901430 chr3R 3675761..3676870 1972..865 5010 97.6 Minus
chr3L 24539361 chr3L 18823469..18824575 1973..866 5005 97.7 Minus
chr4 1351717 chr4 228208..229315 864..1972 4995 97.7 Plus
chrYHet 347003 chrYHet 299533..300657 858..1979 4975 97.2 Plus
chrU 10048995 chrU 5536003..5537127 858..1979 4975 97.2 Plus
chrX 22417052 chrX 15163698..15164805 1970..865 4970 97.4 Minus
chr2L 23010047 chr2L 20900046..20901152 1972..865 4960 97.5 Minus
chr3RHet 2517486 chr3RHet 2358557..2359662 866..1972 4955 97.5 Plus
chr3LHet 2555433 chr3LHet 560821..561951 857..1973 4935 96.6 Plus
chr3R 27901430 chr3R 435314..436420 865..1972 4930 97.3 Plus
chr3L 24539361 chr3L 23130373..23131479 866..1971 4925 97.1 Plus
chrU 10048995 chrU 6192553..6193659 866..1972 4910 97.4 Plus
chr3R 27901430 chr3R 26061312..26062413 865..1967 4905 97.3 Plus
chr3L 24539361 chr3L 23050492..23051596 865..1970 4815 96.7 Plus
chrU 10048995 chrU 2837874..2838979 1972..866 4740 96.4 Minus
chr2L 23010047 chr2L 16279165..16280278 1970..857 4705 95.8 Minus
chr4 1351717 chr4 477316..478425 865..1973 4685 95.6 Plus
chr2R 21145070 chr2R 5893401..5894507 866..1972 4670 95.8 Plus
chrU 10048995 chrU 1108096..1109200 1970..866 4660 95.8 Minus
chrU 10048995 chrU 3437436..3438540 866..1970 4660 95.8 Plus
chr3RHet 2517486 chr3RHet 1242304..1243402 866..1973 4655 95.7 Plus
chr3RHet 2517486 chr3RHet 1250918..1252016 866..1973 4655 95.7 Plus
chr3RHet 2517486 chr3RHet 1472645..1473743 1973..866 4655 95.7 Minus
chr3RHet 2517486 chr3RHet 1205805..1206902 865..1971 4650 95.7 Plus
chrU 10048995 chrU 1088067..1089176 865..1974 4640 95.5 Plus
chr3RHet 2517486 chr3RHet 1669801..1670907 1972..866 4640 95.6 Minus
chrU 10048995 chrU 6157108..6158209 871..1970 4630 96.7 Plus
chr3RHet 2517486 chr3RHet 1018315..1019431 1974..858 4630 95.3 Minus
chrU 10048995 chrU 1176277..1177381 866..1970 4600 95.4 Plus
chr2R 21145070 chr2R 510618..511717 1970..865 4595 95.8 Minus
chrU 10048995 chrU 7849265..7850374 863..1972 4595 95.2 Plus
chr3RHet 2517486 chr3RHet 2281389..2282488 865..1972 4595 95.5 Plus
chr2L 23010047 chr2L 22336908..22338014 1970..865 4590 95.5 Minus
chr2R 21145070 chr2R 902406..903513 1970..863 4580 95.6 Minus
chrU 10048995 chrU 2110491..2111591 872..1972 4560 95.7 Plus
chr3L 24539361 chr3L 23635892..23636995 1973..866 4545 95.4 Minus
chr3L 24539361 chr3L 23685537..23686651 1979..857 4535 94.8 Minus
chr2L 23010047 chr2L 22261662..22262753 1972..866 4505 95.4 Minus
chr3L 24539361 chr3L 24445154..24446259 865..1970 4500 94.8 Plus
chr2R 21145070 chr2R 10384745..10385852 1972..866 4475 94.8 Minus
chrU 10048995 chrU 6412664..6413769 1970..865 4470 94.6 Minus
chr3R 27901430 chr3R 4720851..4721946 1970..866 4460 94.8 Minus
chr2R 21145070 chr2R 100675..101782 1973..866 4460 95.1 Minus
chr4 1351717 chr4 323237..324336 866..1973 4455 94.7 Plus
chr4 1351717 chr4 327195..328303 865..1972 4395 94.5 Plus
chr3RHet 2517486 chr3RHet 2192898..2193979 1970..880 4390 94.7 Minus
chr3L 24539361 chr3L 24275041..24276147 1970..865 4365 94.1 Minus
chrU 10048995 chrU 1100655..1101744 866..1972 4360 94.3 Plus
chr3L 24539361 chr3L 15075157..15076265 865..1972 4345 94 Plus
chr3RHet 2517486 chr3RHet 1508676..1509781 866..1972 4335 94 Plus
chr2R 21145070 chr2R 1029855..1030941 865..1970 4330 94 Plus
chr3RHet 2517486 chr3RHet 1454612..1455716 1971..866 4330 94 Minus
chr3L 24539361 chr3L 24010243..24011342 866..1973 4320 94.4 Plus
chrU 10048995 chrU 1104306..1105395 1972..866 4315 94.1 Minus
chrU 10048995 chrU 3444893..3445983 1972..866 4315 94.2 Minus
chrU 10048995 chrU 9119548..9120581 913..1973 4315 95 Plus
chrU 10048995 chrU 6441526..6442627 866..1972 4310 94.2 Plus
chr3L 24539361 chr3L 1485302..1486409 865..1970 4305 94 Plus
chr2L 23010047 chr2L 17334280..17335386 1970..865 4305 93.8 Minus
chr3RHet 2517486 chr3RHet 818394..819498 1970..865 4300 94 Minus
chr4 1351717 chr4 1262800..1263889 1970..865 4295 94 Minus
chrU 10048995 chrU 1837211..1838308 866..1970 4295 94.4 Plus
chr3RHet 2517486 chr3RHet 100799..101826 937..1972 4295 95.6 Plus
chr3RHet 2517486 chr3RHet 533710..534816 1971..866 4290 93.9 Minus
chrU 10048995 chrU 6137007..6138089 880..1970 4285 94.1 Plus
chr3L 24539361 chr3L 23515441..23516553 1973..866 4270 94 Minus
chrU 10048995 chrU 3441241..3442331 866..1972 4270 94 Plus
chr3RHet 2517486 chr3RHet 2262615..2263697 1970..880 4270 94 Minus
chr3L 24539361 chr3L 24509535..24510635 865..1972 4260 93.9 Plus
chr3RHet 2517486 chr3RHet 911623..912718 1975..865 4250 93.4 Minus
chr2R 21145070 chr2R 637983..639082 866..1973 4245 93.4 Plus
chr3RHet 2517486 chr3RHet 1023380..1024407 1885..858 4245 95.2 Minus
chr4 1351717 chr4 315257..316302 1918..866 4225 94.9 Minus
chrU 10048995 chrU 1514820..1515925 1970..865 4215 93.4 Minus
chr2L 23010047 chr2L 22732547..22733643 1972..865 4195 93.3 Minus
chr3L 24539361 chr3L 23570806..23571859 1971..916 4185 95.1 Minus
chrX 22417052 chrX 2558255..2559343 1973..866 4185 93.4 Minus
chr3L 24539361 chr3L 23639332..23640388 916..1972 4170 94.5 Plus
chrU 10048995 chrU 8815412..8816471 1939..866 4165 94.2 Minus
chr3L 24539361 chr3L 23169575..23170601 949..1972 4145 94.9 Plus
chrU 10048995 chrU 7963292..7964344 1973..930 4135 94.3 Minus
chr4 1351717 chr4 952279..953384 1973..865 4100 92.8 Minus
chr3R 27901430 chr3R 19338963..19340066 1972..866 4090 92.7 Minus
chr4 1351717 chr4 928482..929524 916..1972 4085 93.7 Plus
chr4 1351717 chr4 1279217..1280310 1970..866 4055 92.5 Minus
chr3RHet 2517486 chr3RHet 2006044..2007147 1972..866 4050 92.6 Minus
chrU 10048995 chrU 7395539..7396473 1796..865 4040 96.7 Minus
chr3L 24539361 chr3L 23483762..23484814 1971..916 4030 93.7 Minus
chrU 10048995 chrU 7464981..7466012 1922..866 3995 93.8 Minus
chr4 1351717 chr4 878283..879394 865..1970 3940 91.4 Plus
chrU 10048995 chrU 1455830..1456919 1969..866 3935 92.5 Minus
chr3RHet 2517486 chr3RHet 385982..386987 1865..865 3920 94 Minus
chrU 10048995 chrU 2546361..2547472 865..1972 3900 91.4 Plus
chr3L 24539361 chr3L 24269411..24270493 866..1970 3860 92.2 Plus
chrU 10048995 chrU 6928885..6929853 865..1853 3820 93.8 Plus
chr4 1351717 chr4 1278365..1279216 866..1715 3780 97.3 Plus
chrU 10048995 chrU 9038425..9039439 1882..865 3770 93 Minus
chr2L 23010047 chr2L 21580796..21581647 866..1715 3765 97.2 Plus
chrU 10048995 chrU 6959422..6960265 1972..1130 3745 97 Minus
chrU 10048995 chrU 7624922..7625855 1970..1042 3595 94.2 Minus
chr3L 24539361 chr3L 24459950..24460869 1048..1970 3535 93.9 Plus
chrU 10048995 chrU 9808123..9809062 1876..916 3530 93.3 Minus
chr4 1351717 chr4 975764..976715 1010..1970 3520 92.4 Plus
chrU 10048995 chrU 9984986..9985865 865..1753 3375 93.7 Plus
chrYHet 347003 chrYHet 325598..326452 1747..891 3355 94.3 Minus
chr3L 24539361 chr3L 24280986..24281946 989..1970 3340 91.6 Plus
chr3R 27901430 chr3R 3799416..3800148 1972..1237 3325 97.7 Minus
chrU 10048995 chrU 9437693..9438461 1973..1204 3285 96.2 Minus
chr3RHet 2517486 chr3RHet 267465..268257 858..1651 3210 94.7 Plus
chrU 10048995 chrU 8215027..8215856 1754..916 3195 93.9 Minus
chrYHet 347003 chrYHet 318308..319155 1747..891 3140 92.9 Minus
chrU 10048995 chrU 7381178..7381952 865..1642 3125 94.9 Plus
chrU 10048995 chrU 451432..452135 865..1565 3070 96.7 Plus
chrU 10048995 chrU 5556445..5557167 1212..1918 3050 95.7 Plus
chr2R 21145070 chr2R 4453642..4454433 865..1653 3045 93.7 Plus
chr3L 24539361 chr3L 23054267..23054902 1971..1336 2935 98.1 Minus
chr2R 21145070 chr2R 479572..480494 1970..1017 2915 89.3 Minus
chrU 10048995 chrU 6658724..6659577 1086..1973 2880 90.3 Plus
chr3RHet 2517486 chr3RHet 2368182..2368978 865..1686 2860 92 Plus
chr3RHet 2517486 chr3RHet 1330223..1330922 1565..866 2850 94.7 Minus
chr2R 21145070 chr2R 584115..584816 865..1565 2840 94.9 Plus
chrU 10048995 chrU 7807583..7808226 1518..865 2830 96.5 Minus
chr3L 24539361 chr3L 1489941..1490550 1364..1973 2790 97.9 Plus
chr3RHet 2517486 chr3RHet 1325797..1326495 1565..866 2785 94.4 Minus
chrU 10048995 chrU 973096..973805 1579..861 2740 93.6 Minus
chrU 10048995 chrU 6701708..6702417 861..1579 2740 93.6 Plus
chrU 10048995 chrU 8047561..8048207 1512..866 2705 95.5 Minus
chrU 10048995 chrU 9372328..9373017 866..1553 2645 93.5 Plus
chrU 10048995 chrU 1808384..1809030 865..1512 2630 95.1 Plus
chrU 10048995 chrU 6434511..6435189 1282..1969 2595 93.5 Plus
chr3L 24539361 chr3L 23829712..23830477 1783..1010 2560 91.1 Minus
chr3R 27901430 chr3R 365297..365851 1418..866 2525 97.8 Minus
chrU 10048995 chrU 6158790..6159340 1413..865 2520 98 Minus
chrYHet 347003 chrYHet 101994..102672 866..1565 2515 91.9 Plus
chrU 10048995 chrU 5333555..5334187 1502..865 2485 94.4 Minus
chrU 10048995 chrU 1186112..1186795 865..1568 2460 91.5 Plus
chrU 10048995 chrU 9629465..9630078 1480..866 2435 94.5 Minus
chrX 22417052 chrX 9993470..9993995 1973..1447 2375 97.2 Minus
chrU 10048995 chrU 2003126..2003668 1427..1970 2370 96.5 Plus
chr2L 23010047 chr2L 22521044..22521580 1972..1435 2370 96.5 Minus
chr3RHet 2517486 chr3RHet 2034396..2034925 1445..1973 2370 97.7 Plus
chr4 1351717 chr4 453212..453749 1435..1972 2355 96.7 Plus
chr3RHet 2517486 chr3RHet 2328512..2329066 866..1418 2345 95.7 Plus
chr4 1351717 chr4 474626..475180 866..1418 2330 95.5 Plus
chr3L 24539361 chr3L 23124272..23124826 866..1418 2315 95.3 Plus
chr4 1351717 chr4 203807..204360 1418..866 2310 95.7 Minus
chr3R 27901430 chr3R 364652..365187 1970..1435 2280 96.7 Minus
chrX 22417052 chrX 21834842..21835397 865..1418 2275 94.8 Plus
chr3RHet 2517486 chr3RHet 1933050..1933604 866..1418 2270 94.8 Plus
chr3R 27901430 chr3R 26641298..26641855 863..1418 2255 94.4 Plus
chr3L 24539361 chr3L 24365472..24366002 865..1393 2240 95.7 Plus
chr4 1351717 chr4 1197046..1197570 1970..1441 2230 96.4 Minus
chr2L 23010047 chr2L 21400046..21400570 870..1393 2225 96.2 Plus
chr3RHet 2517486 chr3RHet 812998..813552 1418..866 2225 94.2 Minus
chr2L 23010047 chr2L 22521644..22522173 1393..866 2220 95.5 Minus
chr2R 21145070 chr2R 1289131..1289685 865..1418 2210 94.4 Plus
chr4 1351717 chr4 452589..453143 866..1418 2210 94.1 Plus
chr3RHet 2517486 chr3RHet 1095631..1096219 1379..1970 2195 93.3 Plus
chr2L 23010047 chr2L 22858276..22858795 876..1393 2185 95.6 Plus
chr3L 24539361 chr3L 24492635..24493163 865..1390 2165 95.3 Plus
chr3RHet 2517486 chr3RHet 676430..676989 1418..865 2155 93.6 Minus
chr2L 23010047 chr2L 22440842..22441371 1393..866 2145 94.5 Minus
chr3RHet 2517486 chr3RHet 553268..553818 866..1418 2145 93.7 Plus
chr4 1351717 chr4 54451..55005 866..1418 2135 93.2 Plus
chr3RHet 2517486 chr3RHet 1591159..1591713 865..1418 2135 93.5 Plus
chr3L 24539361 chr3L 24486659..24487181 1448..1970 2130 94.7 Plus
chr3RHet 2517486 chr3RHet 706471..707006 1399..865 2130 94.4 Minus
chr3RHet 2517486 chr3RHet 762833..763355 1418..895 2130 95.4 Minus
chr3L 24539361 chr3L 23477182..23477711 865..1393 2115 94.5 Plus
chr3L 24539361 chr3L 24493285..24493819 1435..1970 2115 94.2 Plus
chrX 22417052 chrX 9993996..9994479 1346..865 2110 96.7 Minus
chrYHet 347003 chrYHet 307512..308069 1472..916 2105 93.4 Minus
chr3RHet 2517486 chr3RHet 1816683..1817236 865..1418 2085 93.3 Plus
chr3RHet 2517486 chr3RHet 2317392..2317915 1970..1435 2085 93.9 Minus
chr2R 21145070 chr2R 323347..323858 1375..866 2070 94.5 Minus
chr2R 21145070 chr2R 350442..350953 866..1375 2070 94.5 Plus
chr4 1351717 chr4 46333..46862 1393..865 2070 94 Minus
chr2L 23010047 chr2L 19735933..19736486 865..1418 2070 93.2 Plus
chr3L 24539361 chr3L 24322368..24322924 1418..865 2065 93 Minus
chr3RHet 2517486 chr3RHet 1145339..1145891 866..1418 2065 93.2 Plus
chr2R 21145070 chr2R 2146680..2147185 1431..1937 2060 95.1 Plus
chr3L 24539361 chr3L 24371484..24372040 865..1418 2050 92.8 Plus
chr2R 21145070 chr2R 1289810..1290332 1454..1972 2045 94.5 Plus
chr3L 24539361 chr3L 23078239..23078767 1970..1443 2035 94 Minus
chr3L 24539361 chr3L 21487825..21488295 864..1332 2030 96.4 Plus
chr4 1351717 chr4 1188244..1188795 865..1418 2015 92.8 Plus
chr3L 24539361 chr3L 23404851..23405373 858..1385 2000 93.6 Plus
chr4 1351717 chr4 74099..74630 1393..865 2000 93.8 Minus
chr3L 24539361 chr3L 23230832..23231373 866..1418 1975 92.1 Plus
chr3L 24539361 chr3L 23400069..23400602 1435..1974 1970 92.6 Plus
chr4 1351717 chr4 955105..955595 865..1353 1965 94.3 Plus
chr4 1351717 chr4 1188894..1189379 1486..1971 1945 94.3 Plus
chr4 1351717 chr4 1197569..1198037 1382..916 1940 96.2 Minus
chr3L 24539361 chr3L 23073091..23073574 1486..1969 1935 94.2 Plus
chr4 1351717 chr4 1261677..1262167 865..1353 1935 93.9 Plus
chrYHet 347003 chrYHet 311937..312422 1496..1970 1920 94.9 Plus
chr3RHet 2517486 chr3RHet 2184565..2185056 927..1418 1910 94.3 Plus
chr2R 21145070 chr2R 54979..55525 864..1418 1905 91.6 Plus
chr3L 24539361 chr3L 23078902..23079442 1418..865 1905 91.2 Minus
chrYHet 347003 chrYHet 326548..327033 1496..1970 1905 94.7 Plus
chr3RHet 2517486 chr3RHet 1810167..1810682 1970..1450 1900 93.1 Minus
chr3L 24539361 chr3L 23054899..23055339 1303..865 1895 96.4 Minus
chr2R 21145070 chr2R 150148..150694 864..1418 1890 91.4 Plus
chr2R 21145070 chr2R 2146144..2146661 865..1390 1885 92.2 Plus
chr2R 21145070 chr2R 1313321..1313842 1392..865 1870 91.5 Minus
chr3L 24539361 chr3L 24249762..24250226 1973..1509 1870 94.4 Minus
chr2R 21145070 chr2R 57243..57729 1486..1972 1860 93 Plus
chr3L 24539361 chr3L 23231471..23231957 1486..1973 1860 93.5 Plus
chr3RHet 2517486 chr3RHet 139547..140074 1393..857 1860 91.8 Minus
chr3RHet 2517486 chr3RHet 1709798..1710267 916..1393 1845 93.8 Plus
chr3RHet 2517486 chr3RHet 639061..639575 1393..865 1805 91.5 Minus
chr2L 23010047 chr2L 22404149..22404610 957..1418 1790 94.4 Plus
chr3RHet 2517486 chr3RHet 1303089..1303533 1393..943 1785 94.5 Minus
chr2L 23010047 chr2L 22870563..22871024 1515..1970 1775 93.7 Plus
chr3L 24539361 chr3L 23399367..23399956 858..1416 1770 89 Plus
chr3RHet 2517486 chr3RHet 853246..853668 1972..1550 1750 95.3 Minus
chr3RHet 2517486 chr3RHet 2185166..2185682 1435..1971 1750 90.5 Plus
chr3L 24539361 chr3L 23763535..23763984 1933..1486 1745 94.5 Minus
chrX 22417052 chrX 21785588..21786045 1435..1908 1710 91.6 Plus
chrX 22417052 chrX 21790884..21791341 1435..1908 1710 91.6 Plus
chr3RHet 2517486 chr3RHet 186725..187270 865..1419 1710 89.2 Plus
chr3L 24539361 chr3L 24022989..24023456 1330..866 1700 92.8 Minus
chrYHet 347003 chrYHet 319251..319705 1496..1970 1695 91.8 Plus
chr3RHet 2517486 chr3RHet 560183..560712 1970..1435 1695 89.7 Minus
chr3RHet 2517486 chr3RHet 2318063..2318602 1418..865 1690 89 Minus
chr3RHet 2517486 chr3RHet 812407..812930 1971..1436 1685 90.1 Minus
chr3RHet 2517486 chr3RHet 773021..773417 1418..1024 1660 95.7 Minus
chr3L 24539361 chr3L 24150641..24151016 1597..1972 1635 96.8 Plus
chr3RHet 2517486 chr3RHet 762151..762621 1972..1505 1630 91 Minus
chr2R 21145070 chr2R 11259996..11260430 1321..888 1625 93.1 Minus
chr2R 21145070 chr2R 1518085..1518528 1972..1507 1615 91.2 Minus
chrX 22417052 chrX 21641858..21642290 1418..986 1615 93.6 Minus
chr3L 24539361 chr3L 24532944..24533411 1393..920 1610 92.1 Minus
chr3L 24539361 chr3L 24536442..24536909 1393..920 1610 92.1 Minus
chr4 1351717 chr4 62147..62596 915..1362 1610 91.6 Plus
chr2L 23010047 chr2L 22858993..22859363 1602..1972 1610 96.8 Plus
chr2R 21145070 chr2R 1441063..1441506 1507..1972 1585 90.8 Plus
chr2R 21145070 chr2R 538618..539031 1559..1970 1580 93.7 Plus
chrYHet 347003 chrYHet 102676..103046 1602..1972 1580 96.2 Plus
chr4 1351717 chr4 45761..46129 1970..1602 1570 96.2 Minus
chr3L 24539361 chr3L 24407176..24407726 1418..866 1545 88.4 Minus
chr3L 24539361 chr3L 23477916..23478285 1602..1972 1530 96 Plus
chr2L 23010047 chr2L 21570420..21570805 1035..1418 1530 94.3 Plus
chr3L 24539361 chr3L 24366214..24366582 1602..1970 1525 95.4 Plus
chr2R 21145070 chr2R 719107..719519 1559..1970 1515 92.8 Plus
chr4 1351717 chr4 633539..633992 1341..874 1515 90.6 Minus
chr2R 21145070 chr2R 718049..718445 1017..1411 1510 93.2 Plus
chr2L 23010047 chr2L 22477877..22478264 865..1251 1510 94.3 Plus
chr2R 21145070 chr2R 148067..148441 1599..1973 1480 94.1 Plus
chr2L 23010047 chr2L 22456387..22456773 1251..866 1475 93.8 Minus
chr2L 23010047 chr2L 22250436..22250804 1602..1972 1470 94.9 Plus
chr2L 23010047 chr2L 22249785..22250241 915..1393 1430 88.8 Plus
chr4 1351717 chr4 203327..203697 1804..1435 1395 93.5 Minus
chr2L 23010047 chr2L 22348048..22348541 1370..865 1385 87.6 Minus
chr4 1351717 chr4 1271838..1272329 1365..874 1375 87.8 Minus
chr2L 23010047 chr2L 22884915..22885380 911..1381 1375 88.9 Plus
chr2L 23010047 chr2L 21571028..21571386 1391..1035 1365 93.3 Minus
chr2L 23010047 chr2L 22440203..22440551 1974..1628 1360 94 Minus
chr2R 21145070 chr2R 584820..585177 1602..1970 1355 93 Plus
chr4 1351717 chr4 809526..809873 1973..1628 1355 94 Minus
chr4 1351717 chr4 73586..73988 1898..1486 1350 91.1 Minus
chrX 22417052 chrX 21641170..21641600 1970..1524 1350 88.2 Minus
chr2L 23010047 chr2L 19738997..19739342 1628..1970 1345 93.9 Plus
chr3R 27901430 chr3R 26642461..26642807 1628..1972 1335 93.7 Plus
chr4 1351717 chr4 55577..55921 1628..1971 1315 92.8 Plus
chrX 22417052 chrX 12662133..12662444 1602..1913 1300 95.8 Plus
chr2L 23010047 chr2L 22478687..22479046 1602..1973 1295 92.2 Plus
chrX 22417052 chrX 21785242..21785519 1142..1418 1280 98.2 Plus
chrX 22417052 chrX 21790538..21790815 1142..1418 1280 98.2 Plus
chr4 1351717 chr4 1260641..1261142 865..1391 1245 86.3 Plus
chr3R 27901430 chr3R 3800152..3800419 1133..866 1235 97.4 Minus
chr2L 23010047 chr2L 21581678..21581942 1709..1973 1235 97.7 Plus
chr2R 21145070 chr2R 1523924..1524400 865..1363 1230 85.8 Plus
chr4 1351717 chr4 1280311..1280574 1709..1972 1230 97.7 Plus
chr4 1351717 chr4 388148..388488 1203..865 1215 91.8 Minus
chr2R 21145070 chr2R 315066..315404 1210..874 1205 91.7 Minus
chr3R 27901430 chr3R 391093..391357 1713..1977 1190 96.6 Plus
chr4 1351717 chr4 633122..633450 1766..1435 1150 93.1 Minus
chr2L 23010047 chr2L 22217003..22217405 1970..1559 1105 87.2 Minus
chr2R 21145070 chr2R 1029127..1029367 865..1105 1085 96.7 Plus
chrX 22417052 chrX 18020881..18021310 1312..865 1070 85.6 Minus
chr2R 21145070 chr2R 1418049..1418484 1366..916 1045 86.1 Minus
chr2R 21145070 chr2R 498571..498862 1672..1970 1040 90.6 Plus
chr2R 21145070 chr2R 1312771..1313064 1972..1672 1035 90.4 Minus
chrX 22417052 chrX 21835557..21835856 1628..1933 1030 91.2 Plus
chr2R 21145070 chr2R 2350232..2350534 1970..1672 1015 90.5 Minus
chr2R 21145070 chr2R 504396..504690 1973..1672 1010 89.7 Minus
chr2L 23010047 chr2L 22218972..22219450 1365..865 980 82.5 Minus
chr2R 21145070 chr2R 1524721..1525012 1672..1970 950 88.6 Plus
chrX 22417052 chrX 21785004..21785234 871..1106 950 94.5 Plus
chrX 22417052 chrX 21790300..21790530 871..1106 950 94.5 Plus
chr4 1351717 chr4 981550..981801 1721..1972 945 91.7 Plus
chr2R 21145070 chr2R 1417401..1417762 1929..1559 935 86.6 Minus
chr2R 21145070 chr2R 526474..526726 1972..1721 930 92.1 Minus
chr4 1351717 chr4 475249..475507 1435..1698 930 93.6 Plus
chr4 1351717 chr4 1262373..1262606 1602..1835 925 94.9 Plus
chr2R 21145070 chr2R 152442..152669 1745..1972 915 93.4 Plus
chr4 1351717 chr4 955801..956033 1602..1835 910 94.5 Plus
chr2R 21145070 chr2R 903619..903911 1672..1970 890 88 Plus
chr2R 21145070 chr2R 914347..914587 866..1106 890 91.3 Plus
chr4 1351717 chr4 394848..395250 1365..967 885 84.4 Minus
chr2L 23010047 chr2L 22827650..22828030 1955..1561 875 84.3 Minus
chr2L 23010047 chr2L 22848775..22849155 1955..1561 875 84.3 Minus
chr2R 21145070 chr2R 396217..396465 1970..1721 870 90.8 Minus
chr2R 21145070 chr2R 73573..73915 1300..955 860 85.9 Minus
chrX 22417052 chrX 22116814..22117065 1721..1972 855 89.3 Plus
chr4 1351717 chr4 338787..339085 1974..1672 845 86.6 Minus
chr2L 23010047 chr2L 22716585..22716869 1079..1363 845 89.5 Plus
chr2L 23010047 chr2L 22723698..22723982 1079..1363 845 89.5 Plus
chr2L 23010047 chr2L 22769879..22770163 1363..1079 845 89.5 Minus
chr2L 23010047 chr2L 22776997..22777281 1363..1079 845 89.5 Minus
chr4 1351717 chr4 454847..455229 1411..1011 820 83.7 Minus
chrX 22417052 chrX 22124167..22124483 865..1180 810 85.8 Plus
chr4 1351717 chr4 1261466..1261680 1721..1931 800 92.6 Plus
chr2L 23010047 chr2L 22885648..22885879 1724..1955 800 89.7 Plus
chr2L 23010047 chr2L 22347484..22347732 1929..1673 795 89.1 Minus
chrYHet 347003 chrYHet 136211..136540 1002..1346 780 85 Plus
chr2L 23010047 chr2L 21149717..21149905 1058..870 780 94.2 Minus
chr2R 21145070 chr2R 80884..81099 865..1079 775 91.7 Plus
chr4 1351717 chr4 632939..633120 1972..1791 775 95.1 Minus
chr2L 23010047 chr2L 22440578..22440778 1637..1435 765 94.1 Minus
chr2R 21145070 chr2R 470278..470508 1739..1970 750 89.2 Plus
chr4 1351717 chr4 229311..229520 1931..1721 750 91.5 Minus
chr4 1351717 chr4 980714..981065 865..1215 750 83.6 Plus
chr4 1351717 chr4 339592..339867 1182..899 725 86.8 Minus
chr2R 21145070 chr2R 396735..397036 1365..1063 720 86.2 Minus
chr4 1351717 chr4 13288..13592 1399..1094 720 86.7 Minus
chrX 22417052 chrX 1408068..1408253 866..1051 720 92.5 Plus
chr2L 23010047 chr2L 22359399..22359860 1336..865 720 80 Minus
chr2R 21145070 chr2R 1198671..1198897 1672..1905 715 88 Plus
chr2R 21145070 chr2R 2228926..2229341 933..1365 710 80.6 Plus
chrX 22417052 chrX 21781995..21782279 1341..1064 690 86 Minus
chrX 22417052 chrX 21804496..21804780 1341..1064 675 85.7 Minus
chr2L 23010047 chr2L 21569219..21569368 865..1014 675 96.7 Plus
chr2L 23010047 chr2L 22111642..22111937 1859..1559 675 84.5 Minus
chr2L 23010047 chr2L 21570281..21570422 864..1005 650 97.2 Plus
chr2L 23010047 chr2L 22404739..22404897 1435..1594 645 95 Plus
chrYHet 347003 chrYHet 307357..307514 1972..1815 640 93.7 Minus
chrX 22417052 chrX 20898515..20898656 866..1007 620 95.8 Plus
chr2L 23010047 chr2L 21570874..21571021 1435..1583 620 96 Plus
chrX 22417052 chrX 22107839..22108049 1970..1761 615 87.2 Minus
chrX 22417052 chrX 21831674..21832040 1973..1576 610 79.2 Minus
chr2L 23010047 chr2L 21400634..21400765 1435..1566 600 97 Plus
chr2L 23010047 chr2L 21571384..21571524 1005..865 600 95 Minus
chrX 22417052 chrX 12661999..12662129 1435..1565 595 96.9 Plus
chr2L 23010047 chr2L 22456246..22456384 1418..1280 590 95 Minus
chr2L 23010047 chr2L 22478267..22478405 1280..1418 590 95 Plus
chrX 22417052 chrX 6649442..6649591 883..1031 535 92 Plus
chrX 22417052 chrX 20898652..20898798 1028..1173 520 91.8 Plus
chrX 22417052 chrX 21838340..21838583 1722..1971 520 83.1 Plus
chr3R 27901430 chr3R 1650006..1650105 100..1 500 100 Minus
chrX 22417052 chrX 22108479..22108675 1116..922 500 84.8 Minus
chrX 22417052 chrX 12661798..12661933 1246..1393 480 89.9 Plus
chrYHet 347003 chrYHet 233913..234178 1882..1602 465 82.6 Minus
chrX 22417052 chrX 22282362..22282505 1221..1365 465 89.7 Plus
chrYHet 347003 chrYHet 76648..76872 1789..1559 435 83.2 Minus
chrYHet 347003 chrYHet 319155..319252 865..962 430 95.9 Plus
chrYHet 347003 chrYHet 326452..326549 865..962 430 95.9 Plus
chrX 22417052 chrX 22313816..22314073 1187..920 425 80.7 Minus
chrX 22417052 chrX 22320279..22320480 1077..864 420 80.8 Minus
chrX 22417052 chrX 20646884..20647121 966..1211 380 79.8 Plus
chrYHet 347003 chrYHet 311841..311935 865..959 370 92.6 Plus
chrX 22417052 chrX 20028965..20029134 1133..964 370 81.2 Minus
chrX 22417052 chrX 21811460..21811552 916..1012 360 93.8 Plus
chrYHet 347003 chrYHet 77214..77310 1365..1265 350 92.1 Minus
chrX 22417052 chrX 22116607..22116681 1291..1365 330 96 Plus
chr3R 27901430 chr3R 18556633..18556738 953..1058 305 85.8 Plus
chrYHet 347003 chrYHet 234518..234583 1363..1298 300 97 Minus
chr3R 27901430 chr3R 4087668..4087753 984..899 295 89.5 Minus
chrX 22417052 chrX 22341042..22341142 920..1020 295 86.1 Plus
chr3R 27901430 chr3R 26642357..26642434 1559..1637 285 93.7 Plus
chrYHet 347003 chrYHet 234717..234807 1121..1031 275 86.8 Minus
chr3R 27901430 chr3R 15472687..15472780 1873..1969 240 85.6 Plus
chrYHet 347003 chrYHet 233809..233888 1969..1889 235 88.9 Minus
chrX 22417052 chrX 18020623..18020675 1970..1918 235 96.2 Minus
chrX 22417052 chrX 22108127..22108217 1655..1565 230 83.5 Minus
chrX 22417052 chrX 1408282..1408332 1922..1972 225 96.1 Plus
chrX 22417052 chrX 4004336..4004395 866..925 225 91.7 Plus
chrX 22417052 chrX 22282108..22282176 874..942 225 88.4 Plus
chrYHet 347003 chrYHet 311786..311841 946..891 205 91.1 Minus
chrX 22417052 chrX 21811424..21811472 865..913 200 93.9 Plus
chrX 22417052 chrX 21804799..21804888 972..883 195 81.1 Minus
chrX 22417052 chrX 3597256..3597308 1809..1861 190 90.6 Plus
chrX 22417052 chrX 21786043..21786088 1925..1970 185 93.5 Plus
chrX 22417052 chrX 21791339..21791384 1925..1970 185 93.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-RA 684 CG2023-PA 1..684 19..702 3420 100 Plus
CG2023-RB 684 CG2023-PB 1..684 19..702 3420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
CR32010-RA 4242 CR32010-RA 1..55 887..941 275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-RA 2426 CG2023-RA 46..2426 1..2379 11670 99.5 Plus
CG2023-RB 953 CG2023-RB 74..951 1..878 4375 99.9 Plus
Cyp6a14-RE 2959 CG8687-RE 327..1115 1653..865 3050 93.8 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-PA 227 CG2023-PA 1..227 19..699 1056 100 Plus
CG2023-PB 227 CG2023-PB 1..227 19..699 1056 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5822025..5824307 2380..100 11180 99.5 Minus
2R 25286936 2R 5261129..5262238 1972..865 5255 98.6 Minus
3R 32079331 3R 12471071..12472181 1972..864 5215 98.4 Minus
3R 32079331 3R 716813..717923 1973..865 5015 97.6 Minus
3L 28110227 3L 21499361..21500468 866..1971 5015 97.7 Plus
3R 32079331 3R 7849698..7850807 1972..865 5010 97.6 Minus
3L 28110227 3L 18833834..18834940 1973..866 5005 97.7 Minus
4 1348131 4 207614..208721 864..1972 4995 97.7 Plus
Y 3667352 Y 3016588..3017712 858..1979 4975 97.2 Plus
3R 32079331 3R 674702..675807 1972..866 4970 97.6 Minus
3R 32079331 3R 4062059..4063164 866..1972 4970 97.6 Plus
X 23542271 X 15273761..15274868 1970..865 4970 97.4 Minus
2L 23513712 2L 20901511..20902617 1972..865 4960 97.5 Minus
2L 23513712 2L 22488833..22489940 1972..865 4960 97.5 Minus
3R 32079331 3R 710358..711469 1973..865 4955 97.4 Minus
3L 28110227 3L 25075366..25076496 857..1973 4935 96.6 Plus
3R 32079331 3R 4609604..4610710 865..1972 4930 97.3 Plus
3R 32079331 3R 30238818..30239924 865..1972 4930 97.3 Plus
3L 28110227 3L 23141442..23142548 866..1971 4925 97.1 Plus
Y 3667352 Y 1174684..1175786 866..1970 4820 96.9 Plus
3L 28110227 3L 23061574..23062678 865..1970 4815 96.7 Plus
2L 23513712 2L 22504382..22505440 1972..916 4785 97.6 Minus
Y 3667352 Y 1307647..1308766 857..1977 4780 96.3 Plus
2L 23513712 2L 22499798..22500895 1972..865 4780 96.4 Minus
Ymm 880023 Ymm 47632..48737 866..1972 4740 96.4 Plus
2L 23513712 2L 16280309..16281426 1974..857 4725 95.8 Minus
2R 25286936 2R 1065937..1067044 1972..865 4720 96 Minus
2R 25286936 2R 10005906..10007012 866..1972 4685 95.9 Plus
4 1348131 4 456756..457865 865..1973 4685 95.6 Plus
3L 28110227 3L 24915110..24916214 1970..866 4675 95.8 Minus
3R 32079331 3R 2674221..2675319 866..1973 4670 95.8 Plus
2R 25286936 2R 1531769..1532873 1970..866 4660 95.8 Minus
3L 28110227 3L 27737497..27738604 866..1973 4660 95.7 Plus
3R 32079331 3R 2665607..2666705 866..1973 4655 95.7 Plus
3R 32079331 3R 2907308..2908406 1973..866 4655 95.7 Minus
Y 3667352 Y 1172725..1173745 1883..865 4655 97.9 Minus
3R 32079331 3R 2629109..2630206 865..1971 4650 95.7 Plus
3R 32079331 3R 3881881..3882987 866..1972 4640 95.6 Plus
2R 25286936 2R 1511740..1512849 865..1974 4640 95.5 Plus
Y 3667352 Y 1152711..1153731 1883..865 4640 97.8 Minus
Y 3667352 Y 1208493..1209513 1883..865 4640 97.8 Minus
3R 32079331 3R 2308677..2309793 1974..858 4630 95.3 Minus
2R 25286936 2R 2586086..2587193 865..1971 4630 95.3 Plus
U 3151297 U 3147096..3148197 871..1970 4630 96.7 Plus
Y 3667352 Y 1206671..1207691 1883..865 4625 97.7 Minus
2R 25286936 2R 1587957..1589061 866..1970 4600 95.4 Plus
2R 25286936 2R 4623010..4624109 1970..865 4595 95.8 Minus
Y 3667352 Y 1598097..1599206 1972..863 4595 95.2 Minus
U 3151297 U 1594652..1595761 863..1972 4595 95.2 Plus
2L 23513712 2L 22338411..22339517 1970..865 4590 95.5 Minus
3R 32079331 3R 3196092..3197191 1972..865 4580 95.4 Minus
2R 25286936 2R 5014786..5015893 1970..863 4580 95.6 Minus
Ymm 880023 Ymm 85819..86919 872..1972 4560 95.7 Plus
3L 28110227 3L 23646981..23648084 1973..866 4545 95.4 Minus
2R 25286936 2R 3781751..3782821 866..1918 4540 96 Plus
3L 28110227 3L 23696631..23697745 1979..857 4535 94.8 Minus
3R 32079331 3R 703932..705013 1973..865 4510 95 Minus
3L 28110227 3L 26795095..26796201 865..1973 4510 95 Plus
Y 3667352 Y 1240407..1241530 857..1977 4510 94.6 Plus
Y 3667352 Y 1247541..1248664 857..1977 4510 94.6 Plus
2L 23513712 2L 22263132..22264223 1972..866 4505 95.4 Minus
3L 28110227 3L 24456254..24457359 865..1970 4500 94.8 Plus
2R 25286936 2R 14497442..14498549 1972..866 4475 94.8 Minus
Y 3667352 Y 2095848..2096953 865..1970 4470 94.6 Plus
Y 3667352 Y 2998887..2999992 865..1970 4470 94.6 Plus
U 3151297 U 3006127..3007232 1970..865 4470 94.6 Minus
2L 23513712 2L 23170916..23172015 865..1970 4465 95 Plus
3R 32079331 3R 8894928..8896023 1970..866 4460 94.8 Minus
2R 25286936 2R 4213135..4214242 1973..866 4460 95.1 Minus
4 1348131 4 306633..307738 865..1972 4460 94.8 Plus
3L 28110227 3L 27131460..27132554 1971..866 4455 95.1 Minus
4 1348131 4 302674..303774 866..1973 4410 94.6 Plus
3L 28110227 3L 26610395..26611502 1973..865 4405 94.3 Minus
3L 28110227 3L 27058941..27060048 1973..865 4405 94.3 Minus
Y 3667352 Y 3407371..3408480 1970..866 4405 94.5 Minus
3L 28110227 3L 26807873..26808988 1973..865 4400 94.3 Minus
Y 3667352 Y 2819631..2820737 1971..865 4395 94.5 Minus
3R 32079331 3R 3274267..3275348 880..1970 4390 94.7 Plus
3L 28110227 3L 25598302..25599417 1970..866 4380 94 Minus
Y 3667352 Y 1549755..1550862 1972..866 4370 94.1 Minus
3L 28110227 3L 24286142..24287248 1970..865 4365 94.1 Minus
2R 25286936 2R 1524328..1525417 866..1972 4360 94.3 Plus
3L 28110227 3L 15085106..15086214 865..1972 4345 94 Plus
3R 32079331 3R 2943339..2944444 866..1972 4335 94 Plus
3R 32079331 3R 2889275..2890379 1971..866 4330 94 Minus
2R 25286936 2R 5142387..5143473 865..1970 4330 94 Plus
3L 28110227 3L 24520626..24521730 865..1972 4325 94.1 Plus
3L 28110227 3L 24021336..24022435 866..1973 4320 94.4 Plus
2R 25286936 2R 1527979..1529068 1972..866 4315 94.1 Minus
U 3151297 U 2463084..2464185 866..1972 4310 94.2 Plus
3L 28110227 3L 1485764..1486871 865..1970 4305 94 Plus
2L 23513712 2L 17335603..17336709 1970..865 4305 93.8 Minus
3R 32079331 3R 2115866..2116970 1970..865 4300 94 Minus
3R 32079331 3R 562645..563742 866..1970 4295 94.4 Plus
3R 32079331 3R 1332556..1333583 1972..937 4295 95.6 Minus
4 1348131 4 1259218..1260307 1970..865 4295 94 Minus
3R 32079331 3R 418655..419758 866..1973 4290 94.2 Plus
3R 32079331 3R 420748..421851 866..1973 4290 94.2 Plus
3R 32079331 3R 970764..971870 866..1971 4290 93.9 Plus
2R 25286936 2R 1228159..1229253 1971..865 4285 93.9 Minus
3R 32079331 3R 3214884..3215966 880..1970 4270 94 Plus
3L 28110227 3L 23526521..23527633 1973..866 4270 94 Minus
3R 32079331 3R 2209092..2210187 1975..865 4265 93.4 Minus
2R 25286936 2R 3171140..3172231 865..1970 4260 93.8 Plus
3R 32079331 3R 2313742..2314769 1885..858 4245 95.2 Minus
2R 25286936 2R 4750399..4751498 866..1973 4245 93.4 Plus
2R 25286936 2R 1423540..1424650 864..1971 4225 93.6 Plus
4 1348131 4 294683..295728 1918..866 4225 94.9 Minus
U 3151297 U 39202..40307 1970..865 4215 93.4 Minus
3R 32079331 3R 410857..411961 866..1973 4200 93.9 Plus
2R 25286936 2R 2979165..2980255 865..1971 4200 93.8 Plus
3L 28110227 3L 23650422..23651478 916..1972 4200 94.7 Plus
2R 25286936 2R 810673..811769 865..1972 4195 93.3 Plus
2L 23513712 2L 22841322..22842418 1972..865 4195 93.3 Minus
Y 3667352 Y 3243739..3244842 865..1972 4190 93.2 Plus
3L 28110227 3L 23581894..23582947 1971..916 4185 95.1 Minus
3L 28110227 3L 26568813..26569813 972..1972 4185 95.6 Plus
X 23542271 X 2664439..2665527 1973..866 4185 93.4 Minus
2L 23513712 2L 23450885..23451970 865..1970 4170 93.4 Plus
U 3151297 U 2183022..2184081 1939..866 4165 94.2 Minus
3L 28110227 3L 23180643..23181669 949..1972 4160 95 Plus
U 3151297 U 1697582..1698634 1973..930 4135 94.3 Minus
2R 25286936 2R 1409686..1410795 1970..865 4125 93.2 Minus
4 1348131 4 931745..932850 1973..865 4100 92.8 Minus
3R 32079331 3R 23515586..23516689 1972..866 4090 92.7 Minus
4 1348131 4 907952..908994 916..1972 4085 93.7 Plus
3R 32079331 3R 3481015..3482118 866..1972 4065 92.7 Plus
4 1348131 4 1275635..1276728 1970..866 4055 92.5 Minus
U 3151297 U 2997456..2998390 1796..865 4040 96.7 Minus
3L 28110227 3L 23494845..23495897 1971..916 4030 93.7 Minus
3L 28110227 3L 25190125..25191216 866..1972 4010 92.4 Plus
U 3151297 U 2142687..2143718 1922..866 3995 93.8 Minus
4 1348131 4 857743..858854 865..1970 3955 91.5 Plus
3R 32079331 3R 464760..465849 1969..866 3950 92.6 Minus
2R 25286936 2R 1094715..1095804 865..1972 3940 92.2 Plus
3R 32079331 3R 1057091..1058096 865..1865 3920 94 Plus
3R 32079331 3R 1395210..1396278 865..1970 3920 91.5 Plus
Y 3667352 Y 1096872..1097983 865..1972 3900 91.4 Plus
3L 28110227 3L 24280512..24281594 866..1970 3860 92.2 Plus
Y 3667352 Y 911217..912296 871..1970 3840 91.9 Plus
3L 28110227 3L 27868421..27869511 866..1973 3820 91.7 Plus
U 3151297 U 2871103..2872071 865..1853 3820 93.8 Plus
4 1348131 4 1274783..1275634 866..1715 3780 97.3 Plus
U 3151297 U 2644397..2645411 1882..865 3770 93 Minus
2L 23513712 2L 21582301..21583152 866..1715 3765 97.2 Plus
U 3151297 U 1073388..1074231 1972..1130 3745 97 Minus
2R 25286936 2R 1396531..1397530 961..1972 3665 92.6 Plus
U 3151297 U 34356..35427 1970..910 3630 91.1 Minus
2R 25286936 2R 1106195..1107117 1044..1967 3555 94 Plus
3L 28110227 3L 24471050..24471969 1048..1970 3535 93.9 Plus
Ymm 880023 Ymm 537731..538670 1876..916 3530 93.3 Minus
4 1348131 4 955249..956200 1010..1970 3520 92.4 Plus
3L 28110227 3L 24292087..24293047 989..1970 3340 91.6 Plus
3R 32079331 3R 7973369..7974101 1972..1237 3325 97.7 Minus
Ymm 880023 Ymm 590910..591678 1973..1204 3285 96.2 Minus
2R 25286936 2R 3073522..3074338 885..1709 3240 94.4 Plus
3R 32079331 3R 1170019..1170811 1651..858 3210 94.7 Minus
Y 3667352 Y 875789..876618 1754..916 3195 93.9 Minus
Y 3667352 Y 3032656..3033503 1747..891 3140 92.9 Minus
Y 3667352 Y 3039939..3040786 1747..891 3140 92.9 Minus
Ymm 880023 Ymm 557310..558084 865..1642 3125 94.9 Plus
Ymm 880023 Ymm 453533..454322 1656..866 3120 94.1 Minus
3R 32079331 3R 1915382..1916085 865..1565 3070 96.7 Plus
2R 25286936 2R 3877829..3878525 865..1565 3065 96.7 Plus
Y 3667352 Y 897942..898669 1243..1973 3055 95.8 Plus
2R 25286936 2R 8566088..8566876 865..1653 3050 93.8 Plus
2CEN 225573 2CEN 162292..163014 1212..1918 3050 95.7 Plus
3L 28110227 3L 24928670..24929424 1624..865 3025 94.4 Minus
Y 3667352 Y 2769425..2770282 1086..1973 3020 91.1 Plus
3L 28110227 3L 27154924..27155686 1943..1173 2945 94.2 Minus
3L 28110227 3L 23065349..23065984 1971..1336 2935 98.1 Minus
2R 25286936 2R 4591961..4592883 1970..1017 2915 89.3 Minus
3R 32079331 3R 4071685..4072481 865..1686 2860 92 Plus
3R 32079331 3R 2763602..2764301 1565..866 2850 94.7 Minus
2R 25286936 2R 4696530..4697231 865..1565 2840 94.9 Plus
U 3151297 U 3033232..3033875 1518..865 2830 96.5 Minus
3L 28110227 3L 1490406..1491015 1364..1973 2790 97.9 Plus
3R 32079331 3R 2759176..2759874 1565..866 2785 94.4 Minus
X 23542271 X 21975750..21976459 861..1579 2740 93.6 Plus
2R 25286936 2R 3635012..3635746 1241..1972 2735 93 Plus
2R 25286936 2R 3493198..3493869 1310..1972 2710 94.8 Plus
U 3151297 U 3002925..3003571 1512..866 2705 95.5 Minus
Ymm 880023 Ymm 798315..799004 866..1553 2645 93.5 Plus
3R 32079331 3R 533819..534465 865..1512 2630 95.1 Plus
2R 25286936 2R 2280795..2281473 1969..1282 2595 93.5 Minus
U 3151297 U 2846939..2847617 1282..1969 2595 93.5 Plus
3L 28110227 3L 23840812..23841577 1783..1010 2560 91.1 Minus
3L 28110227 3L 26666798..26667471 1257..1933 2560 93.2 Plus
3R 32079331 3R 4539579..4540133 1418..866 2525 97.8 Minus
U 3151297 U 3148778..3149328 1413..865 2520 98 Minus
Y 3667352 Y 617784..618462 866..1565 2515 91.9 Plus
Y 3667352 Y 1989598..1990230 1502..865 2485 94.4 Minus
U 3151297 U 2672003..2672635 1502..865 2485 94.4 Minus
2R 25286936 2R 1597792..1598475 865..1568 2460 91.5 Plus
U 3151297 U 2055018..2055631 1480..866 2435 94.5 Minus
Y 3667352 Y 874444..875069 916..1541 2395 93.8 Plus
3R 32079331 3R 97163..97705 1970..1427 2385 96.7 Minus
X 23542271 X 10101811..10102336 1973..1447 2375 97.2 Minus
3R 32079331 3R 3453236..3453765 1973..1445 2370 97.7 Minus
2L 23513712 2L 23256859..23257407 865..1418 2360 96.2 Plus
2L 23513712 2L 23283082..23283630 865..1418 2360 96.2 Plus
Ymm 880023 Ymm 573835..574428 1973..1377 2360 93.8 Minus
4 1348131 4 432654..433191 1435..1972 2355 96.7 Plus
U 3151297 U 2817801..2818388 1970..1381 2355 94.4 Minus
3R 32079331 3R 4032013..4032567 866..1418 2345 95.7 Plus
2L 23513712 2L 22629824..22630359 1972..1435 2335 96.5 Minus
4 1348131 4 454066..454620 866..1418 2330 95.5 Plus
3R 32079331 3R 3168019..3168584 947..1512 2315 95.1 Plus
3L 28110227 3L 23135341..23135895 866..1418 2315 95.3 Plus
4 1348131 4 183174..183727 1418..866 2310 95.7 Minus
2R 25286936 2R 2945331..2945924 1972..1383 2300 93.6 Minus
3L 28110227 3L 24977405..24977940 1970..1435 2285 95.9 Minus
3R 32079331 3R 4538934..4539469 1970..1435 2280 96.7 Minus
3R 32079331 3R 2449895..2450450 865..1418 2275 94.8 Plus
2R 25286936 2R 3062718..3063273 1418..865 2275 94.8 Minus
3L 28110227 3L 27356749..27357304 1418..865 2275 94.8 Minus
X 23542271 X 22438877..22439432 865..1418 2275 94.8 Plus
Ymm 880023 Ymm 648381..648979 916..1514 2275 93.7 Plus
2R 25286936 2R 552811..553365 866..1418 2270 94.8 Plus
2R 25286936 2R 2831719..2832251 1393..863 2250 95.7 Minus
2R 25286936 2R 2805316..2805871 865..1418 2245 94.4 Plus
3L 28110227 3L 24376572..24377102 865..1393 2240 95.7 Plus
4 1348131 4 1176573..1177097 1970..1441 2230 96.4 Minus
3L 28110227 3L 25077846..25078376 1393..865 2225 95.5 Minus
2L 23513712 2L 21401545..21402069 870..1393 2225 96.2 Plus
2L 23513712 2L 22630423..22630952 1393..866 2220 95.5 Minus
2R 25286936 2R 2006417..2006974 866..1418 2215 94.8 Plus
2L 23513712 2L 23318826..23319351 865..1388 2215 95.6 Plus
2R 25286936 2R 5401721..5402275 865..1418 2210 94.4 Plus
4 1348131 4 432031..432585 866..1418 2210 94.1 Plus
2R 25286936 2R 318877..319437 864..1418 2205 94.1 Plus
U 3151297 U 2802901..2803513 1493..862 2205 91.7 Minus
2R 25286936 2R 1632575..1633103 1393..866 2200 95.7 Minus
3L 28110227 3L 25874543..25875102 865..1418 2200 94.1 Plus
2R 25286936 2R 601846..602404 866..1418 2195 94.1 Plus
2L 23513712 2L 22967028..22967547 876..1393 2185 95.6 Plus
2L 23513712 2L 23185005..23185564 865..1418 2185 93.9 Plus
U 3151297 U 29280..29866 1973..1384 2185 92.9 Minus
Y 3667352 Y 2923291..2923911 865..1490 2175 91.3 Plus
3L 28110227 3L 24503734..24504262 865..1390 2165 95.3 Plus
3L 28110227 3L 25805263..25805821 1418..865 2155 93.2 Minus
3L 28110227 3L 25803192..25803723 1971..1435 2145 95 Minus
2L 23513712 2L 22549602..22550131 1393..866 2145 94.5 Minus
4 1348131 4 33824..34378 866..1418 2135 93.2 Plus
3L 28110227 3L 24497758..24498280 1448..1970 2130 94.7 Plus
2R 25286936 2R 1510549..1511077 1390..865 2125 94.3 Minus
2L 23513712 2L 23189440..23189953 870..1381 2125 95.1 Plus
2R 25286936 2R 1078186..1078718 1972..1435 2120 94.6 Minus
U 3151297 U 1492446..1493009 1418..863 2120 93.8 Minus
2R 25286936 2R 3902060..3902582 865..1387 2115 94.9 Plus
3L 28110227 3L 23488265..23488794 865..1393 2115 94.5 Plus
3L 28110227 3L 24765468..24766002 1435..1970 2110 95 Plus
X 23542271 X 10102337..10102820 1346..865 2110 96.7 Minus
2R 25286936 2R 2259534..2260066 1972..1435 2105 94.4 Minus
Y 3667352 Y 3024567..3025124 1472..916 2105 93.4 Minus
U 3151297 U 2253825..2254357 1435..1972 2105 94.4 Plus
X 23542271 X 22049612..22050165 865..1418 2100 93.5 Plus
X 23542271 X 22085829..22086382 865..1418 2100 93.5 Plus
U 3151297 U 1744888..1745422 1431..1970 2100 94.3 Plus
U 3151297 U 305282..305835 1418..865 2085 93.3 Minus
2R 25286936 2R 6259522..6260027 1431..1937 2075 95.3 Plus
2R 25286936 2R 1267898..1268454 1418..862 2070 93 Minus
4 1348131 4 25706..26235 1393..865 2070 94 Minus
2L 23513712 2L 19737410..19737963 865..1418 2055 93 Plus
4 1348131 4 1167771..1168320 865..1418 2040 92.8 Plus
U 3151297 U 315569..316123 1418..865 2040 93.2 Minus
Ymm 880023 Ymm 695025..695648 1324..1970 2025 90 Plus
4 1348131 4 53466..53997 1393..865 2000 93.8 Minus
Y 3667352 Y 2090596..2091142 865..1414 1980 91.9 Plus
Y 3667352 Y 2993635..2994181 865..1414 1980 91.9 Plus
U 3151297 U 1527705..1528251 1414..865 1980 91.9 Minus
2L 23513712 2L 23283657..23284115 1514..1972 1975 96.3 Plus
U 3151297 U 2070871..2071342 1336..865 1965 95.8 Minus
Ymm 880023 Ymm 642087..642596 916..1418 1950 93.5 Plus
4 1348131 4 1168419..1168904 1486..1971 1945 94.3 Plus
4 1348131 4 1177096..1177564 1382..916 1940 96.2 Minus
4 1348131 4 934588..935078 865..1353 1935 93.9 Plus
4 1348131 4 1258095..1258585 865..1353 1935 93.9 Plus
2L 23513712 2L 23272664..23273123 865..1329 1930 95.7 Plus
Y 3667352 Y 3026277..3026762 1496..1970 1920 94.9 Plus
Y 3667352 Y 2534537..2535038 1418..916 1905 93.7 Minus
Y 3667352 Y 2537399..2537900 1418..916 1905 93.7 Minus
Y 3667352 Y 2584864..2585365 1418..916 1905 93.7 Minus
U 3151297 U 2658699..2659245 1418..864 1905 91.6 Minus
Y 3667352 Y 2525948..2526449 1418..916 1890 93.5 Minus
Y 3667352 Y 2528831..2529332 1418..916 1890 93.5 Minus
Y 3667352 Y 2599346..2599847 1418..916 1890 93.5 Minus
Y 3667352 Y 892236..892745 866..1376 1885 93 Plus
Ymm 880023 Ymm 316709..317188 1350..865 1885 93.9 Minus
Y 3667352 Y 3040887..3041366 1502..1970 1875 94.6 Plus
2L 23513712 2L 23328272..23328821 859..1418 1870 91.3 Plus
Ymm 880023 Ymm 639822..640315 916..1418 1870 93.3 Plus
2L 23513712 2L 23257434..23257888 1514..1972 1865 95.2 Plus
U 3151297 U 3104742..3105251 903..1418 1850 92.3 Plus
U 3151297 U 3032821..3033232 1972..1561 1845 97.6 Minus
Y 3667352 Y 2517307..2517814 1418..916 1810 92.6 Minus
Y 3667352 Y 2520184..2520691 1418..916 1810 92.6 Minus
Y 3667352 Y 2508991..2509498 1418..916 1795 92.4 Minus
Y 3667352 Y 2511844..2512351 1418..916 1795 92.4 Minus
Y 3667352 Y 2523059..2523566 1418..916 1795 92.4 Minus
Y 3667352 Y 2545658..2546165 1418..916 1795 92.4 Minus
U 3151297 U 1219839..1220352 1443..1970 1795 91.9 Plus
2L 23513712 2L 22405640..22406101 957..1418 1790 94.4 Plus
Y 3667352 Y 951489..951989 1376..874 1785 92.1 Minus
Ymm 880023 Ymm 728044..728544 1376..874 1785 92.1 Minus
Y 3667352 Y 1001932..1002445 1438..1973 1780 90.1 Plus
Y 3667352 Y 2506137..2506644 1418..916 1780 92.2 Minus
Y 3667352 Y 2540262..2540769 1418..916 1780 92.2 Minus
Y 3667352 Y 2543131..2543638 1418..916 1780 92.2 Minus
Ymm 880023 Ymm 827767..828280 1973..1438 1780 90.1 Minus
2L 23513712 2L 22979323..22979785 1515..1970 1765 93.5 Plus
Ymm 880023 Ymm 730330..730771 1303..866 1760 94.8 Minus
U 3151297 U 1142196..1142627 1325..896 1760 94.9 Minus
Ymm 880023 Ymm 569020..569523 916..1418 1755 92.5 Plus
Ymm 880023 Ymm 828409..828906 1418..916 1750 92.1 Minus
X 23542271 X 22389624..22390081 1435..1908 1710 91.6 Plus
X 23542271 X 22394920..22395377 1435..1908 1710 91.6 Plus
Ymm 880023 Ymm 729834..730281 1972..1505 1710 92.5 Minus
U 3151297 U 1982277..1982667 1581..1971 1710 96.9 Plus
U 3151297 U 2533233..2533711 1342..865 1710 91.9 Minus
U 3151297 U 1512846..1513254 1271..865 1705 95.6 Minus
Ymm 880023 Ymm 697532..698047 1435..1970 1695 88.6 Plus
U 3151297 U 1274643..1275093 951..1418 1685 92.1 Plus
U 3151297 U 2671570..2672003 1971..1539 1680 95 Minus
Ymm 880023 Ymm 619149..619662 1435..1970 1675 88.8 Plus
Ymm 880023 Ymm 564328..564744 916..1333 1665 94.8 Plus
U 3151297 U 2615732..2616227 1411..913 1660 90.9 Minus
Ymm 880023 Ymm 613555..614024 1331..865 1650 92.4 Minus
U 3151297 U 2226000..2226546 865..1418 1645 88.5 Plus
U 3151297 U 2791597..2791999 1008..1407 1640 95.5 Plus
X 23542271 X 21776700..21777132 1418..986 1615 93.6 Minus
U 3151297 U 2561292..2561773 1418..939 1615 92 Minus
4 1348131 4 41520..41969 915..1362 1610 91.6 Plus
2L 23513712 2L 22967745..22968115 1602..1972 1610 96.8 Plus
4 1348131 4 612967..613429 1341..865 1605 91.4 Minus
U 3151297 U 2461956..2462344 866..1252 1605 95.4 Plus
U 3151297 U 2707194..2707625 1399..951 1605 92 Minus
U 3151297 U 1024019..1024438 1419..995 1590 93.7 Minus
Ymm 880023 Ymm 620081..620585 1970..1440 1585 88.3 Minus
Ymm 880023 Ymm 709857..710354 1970..1451 1580 88.3 Minus
U 3151297 U 2236889..2237274 1035..1418 1575 95.1 Plus
4 1348131 4 25134..25502 1970..1602 1570 96.2 Minus
U 3151297 U 2162259..2162740 1938..1435 1570 89.3 Minus
U 3151297 U 1275187..1275651 1486..1972 1565 90 Plus
Ymm 880023 Ymm 586087..586493 1270..865 1560 93.9 Minus
U 3151297 U 1714883..1715352 1418..942 1560 91.2 Minus
Ymm 880023 Ymm 597577..597981 1566..1970 1540 93.1 Plus
2L 23513712 2L 21571925..21572310 1035..1418 1530 94.3 Plus
2L 23513712 2L 22586657..22587044 865..1251 1510 94.3 Plus
2L 23513712 2L 23330183..23330593 1559..1975 1505 92.3 Plus
2L 23513712 2L 23447248..23447657 1972..1559 1505 92.5 Minus
X 23542271 X 21976481..21976897 1554..1977 1495 92.3 Plus
Ymm 880023 Ymm 98349..98751 1342..941 1480 92.8 Minus
2L 23513712 2L 22565149..22565535 1251..866 1475 93.8 Minus
2L 23513712 2L 22251904..22252272 1602..1972 1470 94.9 Plus
2L 23513712 2L 23319353..23319684 1502..1834 1450 96.4 Plus
Ymm 880023 Ymm 39583..40041 865..1339 1435 90.1 Plus
2L 23513712 2L 22251253..22251709 915..1393 1430 88.8 Plus
Ymm 880023 Ymm 618573..619023 949..1418 1430 89.8 Plus
Ymm 880023 Ymm 849746..850160 1278..866 1425 92.8 Minus
Ymm 880023 Ymm 574992..575393 1343..942 1415 92.8 Minus
2L 23513712 2L 23449882..23450315 1283..865 1400 89.7 Minus
Ymm 880023 Ymm 558085..558381 1675..1971 1395 98 Plus
2L 23513712 2L 22349552..22350045 1370..865 1385 87.6 Minus
4 1348131 4 182694..183064 1804..1435 1380 93.3 Minus
Ymm 880023 Ymm 170842..171364 874..1418 1380 86.5 Plus
4 1348131 4 1268256..1268747 1365..874 1375 87.8 Minus
2L 23513712 2L 22993676..22994141 911..1381 1375 88.9 Plus
Ymm 880023 Ymm 656157..656623 1484..1970 1375 86.9 Plus
2L 23513712 2L 21572533..21572891 1391..1035 1365 93.3 Minus
4 1348131 4 52953..53355 1898..1486 1350 91.1 Minus
X 23542271 X 21776012..21776442 1970..1524 1350 88.2 Minus
X 23542271 X 23394656..23395002 1972..1628 1350 93.9 Minus
2L 23513712 2L 19740474..19740819 1628..1970 1345 93.9 Plus
2L 23513712 2L 22548963..22549311 1974..1628 1345 93.7 Minus
2L 23513712 2L 23186146..23186493 1628..1973 1340 93.7 Plus
2L 23513712 2L 23191006..23191353 1628..1973 1340 93.7 Plus
X 23542271 X 22050416..22050843 1526..1970 1330 88.6 Plus
Ymm 880023 Ymm 699916..700429 1418..916 1330 87.7 Minus
4 1348131 4 788962..789309 1973..1628 1325 93.4 Minus
Ymm 880023 Ymm 556856..557313 1435..1931 1320 86.7 Plus
4 1348131 4 34950..35294 1628..1971 1315 92.8 Plus
2L 23513712 2L 23243172..23243639 895..1365 1315 88.2 Plus
2L 23513712 2L 22587467..22587826 1602..1973 1310 92.5 Plus
X 23542271 X 12771249..12771560 1602..1913 1300 95.8 Plus
2L 23513712 2L 23258968..23259435 895..1365 1300 87.9 Plus
2L 23513712 2L 23274238..23274705 895..1365 1300 87.9 Plus
Ymm 880023 Ymm 606850..607206 916..1273 1285 93.1 Plus
X 23542271 X 22389278..22389555 1142..1418 1280 98.2 Plus
X 23542271 X 22394574..22394851 1142..1418 1265 97.8 Plus
Ymm 880023 Ymm 661673..662154 1418..916 1235 86.2 Minus
Ymm 880023 Ymm 793088..793472 969..1352 1235 91.5 Plus
4 1348131 4 1276729..1276992 1709..1972 1230 97.7 Plus
4 1348131 4 367574..367914 1203..865 1215 91.8 Minus
4 1348131 4 1257059..1257560 865..1391 1215 85.9 Plus
Ymm 880023 Ymm 574428..574786 1215..865 1200 92.2 Minus
Ymm 880023 Ymm 649033..649347 1656..1970 1200 92.1 Plus
Ymm 880023 Ymm 836705..837019 1656..1970 1200 92.1 Plus
Ymm 880023 Ymm 643598..643912 1656..1970 1185 91.7 Plus
X 23542271 X 23399428..23399718 1310..1022 1160 94.8 Minus
Ymm 880023 Ymm 642729..643137 1451..1881 1160 87.3 Plus
4 1348131 4 612550..612878 1766..1435 1150 93.1 Minus
Ymm 880023 Ymm 624123..624434 1656..1970 1150 91.7 Plus
Ymm 880023 Ymm 786150..786628 1376..866 1130 85 Minus
Ymm 880023 Ymm 596401..596641 1714..1954 1115 97.5 Plus
Ymm 880023 Ymm 838348..838666 1098..1418 1100 92.3 Plus
X 23542271 X 22439592..22439891 1628..1933 1030 91.2 Plus
Ymm 880023 Ymm 659589..659934 1418..1073 1030 89.7 Minus
X 23542271 X 18131577..18132004 1312..865 1005 85.1 Minus
X 23542271 X 22389040..22389270 871..1106 950 94.5 Plus
X 23542271 X 22394336..22394566 871..1106 950 94.5 Plus
4 1348131 4 454689..454947 1435..1698 930 93.6 Plus
4 1348131 4 961030..961278 1721..1969 930 91.6 Plus
4 1348131 4 1258791..1259024 1602..1835 925 94.9 Plus
4 1348131 4 935284..935516 1602..1835 910 94.5 Plus
4 1348131 4 374274..374676 1365..967 885 84.4 Minus
X 23542271 X 22720830..22721081 1721..1972 855 89.3 Plus
4 1348131 4 318215..318513 1974..1672 845 86.6 Minus
4 1348131 4 434289..434671 1411..1011 820 83.7 Minus
4 1348131 4 1257884..1258098 1721..1931 800 92.6 Plus
4 1348131 4 319020..319293 1182..899 780 87.4 Minus
X 23542271 X 22728161..22728477 865..1180 780 85.2 Plus
X 23542271 X 22020498..22020782 1064..1341 765 87.8 Plus
4 1348131 4 612367..612548 1972..1791 760 94.5 Minus
4 1348131 4 208717..208926 1931..1721 750 91.5 Minus
4 1348131 4 960195..960545 865..1215 735 83.3 Plus
X 23542271 X 22056925..22057209 1064..1341 735 87.1 Plus
X 23542271 X 22164703..22164993 1074..1365 730 87.1 Plus
X 23542271 X 22174315..22174605 1074..1365 730 87.1 Plus
X 23542271 X 22193947..22194237 1074..1365 730 87.1 Plus
X 23542271 X 1514190..1514375 866..1051 720 92.5 Plus
X 23542271 X 21975406..21975579 863..1037 720 95.4 Plus
X 23542271 X 23403453..23403629 1033..857 720 93.8 Minus
4 1348131 4 248168..248392 1973..1751 715 89.8 Minus
X 23542271 X 21975577..21975752 861..1037 715 94.9 Plus
X 23542271 X 22169433..22169723 1074..1365 715 86.8 Plus
X 23542271 X 22154620..22154909 1074..1365 695 87.1 Plus
X 23542271 X 22179283..22179572 1074..1365 695 87.1 Plus
X 23542271 X 22184167..22184456 1074..1365 695 87.1 Plus
X 23542271 X 22228353..22228642 1074..1365 695 87.1 Plus
X 23542271 X 22386031..22386315 1341..1064 690 86 Minus
X 23542271 X 22144836..22145125 1074..1365 680 86.8 Plus
X 23542271 X 22149567..22149856 1074..1365 680 86.8 Plus
X 23542271 X 22189046..22189335 1074..1365 680 86.8 Plus
X 23542271 X 22243352..22243641 1074..1365 680 86.8 Plus
X 23542271 X 22248378..22248667 1074..1365 680 86.8 Plus
X 23542271 X 22408530..22408814 1341..1064 675 85.7 Minus
X 23542271 X 22159667..22159954 1076..1365 670 86.7 Plus
X 23542271 X 22198952..22199241 1074..1365 665 86.4 Plus
X 23542271 X 22233348..22233637 1074..1365 665 86.4 Plus
X 23542271 X 22223307..22223594 1076..1365 655 86.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5562856..5565138 2380..100 11200 99.5 Minus
2R 25260384 2R 5262328..5263437 1972..865 5275 98.6 Minus
3R 31820162 3R 12211902..12213012 1972..864 5235 98.3 Minus
3L 28103327 3L 21492461..21493568 866..1971 5055 97.6 Plus
3L 28103327 3L 18826934..18828040 1973..866 5055 97.7 Minus
3R 31820162 3R 514391..515501 1973..865 5055 97.5 Minus
3R 31820162 3R 7590529..7591638 1972..865 5050 97.5 Minus
4 1331231 4 207614..208721 864..1972 5045 97.6 Plus
Y 3410481 Y 2863058..2864182 858..1979 5025 97.1 Plus
3R 31820162 3R 3723497..3724602 866..1972 5020 97.5 Plus
3R 31820162 3R 472280..473385 1972..866 5020 97.5 Minus
2L 23513712 2L 22488833..22489940 1972..865 5010 97.4 Minus
2L 23513712 2L 20901511..20902617 1972..865 5010 97.4 Minus
X 23527363 X 15281859..15282966 1970..865 5010 97.3 Minus
3R 31820162 3R 507936..509047 1973..865 5005 97.3 Minus
3R 31820162 3R 29979649..29980755 865..1972 4980 97.2 Plus
3R 31820162 3R 4350435..4351541 865..1972 4980 97.2 Plus
Y 3410481 Y 906609..907711 866..1970 4880 96.9 Plus
3L 28103327 3L 23054674..23055778 865..1970 4865 96.6 Plus
2L 23513712 2L 22504382..22505440 1972..916 4825 97.6 Minus
Y 3410481 Y 904650..905670 1883..865 4695 97.9 Minus
2L 23513712 2L 22499798..22500830 1972..942 4695 97.5 Minus
Y 3410481 Y 940418..941438 1883..865 4680 97.8 Minus
Y 3410481 Y 884636..885656 1883..865 4680 97.8 Minus
Y 3410481 Y 938596..939616 1883..865 4665 97.7 Minus
2R 25260384 2R 3782950..3783938 866..1852 4475 97.4 Plus
4 1331231 4 1257883..1258734 866..1715 3820 97.3 Plus
2L 23513712 2L 21582301..21583152 866..1715 3805 97.1 Plus
3L 28103327 3L 25068466..25069287 857..1678 3735 97.6 Plus
2L 23513712 2L 22263406..22264223 1688..866 3520 96.4 Minus
3R 31820162 3R 7714200..7714932 1972..1237 3355 97.6 Minus
3R 31820162 3R 2936045..2936786 1226..1970 3160 95.5 Plus
3L 28103327 3L 23058449..23059084 1971..1336 2955 98.1 Minus
3L 28103327 3L 1490406..1491015 1364..1973 2810 97.8 Plus
2R 25260384 2R 3879028..3879635 865..1470 2750 97.3 Plus
3R 31820162 3R 1712960..1713558 865..1461 2720 97.4 Plus
3R 31820162 3R 4280410..4280964 1418..866 2545 97.8 Minus
2R 25260384 2R 4624753..4625308 1418..865 2535 97.6 Minus
3L 28103327 3L 23134542..23135096 866..1418 2530 97.6 Plus
3L 28103327 3L 23135107..23135648 1431..1971 2520 97.9 Plus
2R 25260384 2R 5144133..5144672 1431..1970 2520 98.3 Plus
Y 3410481 Y 1213714..1214277 857..1418 2500 96.8 Plus
3R 31820162 3R 2472356..2472897 1431..1973 2495 97.6 Plus
3R 31820162 3R 2704886..2705427 1973..1431 2495 97.6 Minus
3R 31820162 3R 2427245..2427784 1431..1971 2485 97.5 Plus
3R 31820162 3R 2463742..2464283 1431..1973 2480 97.4 Plus
2L 23513712 2L 16280309..16280852 1974..1431 2480 97.6 Minus
2R 25260384 2R 10007670..10008211 1431..1972 2470 97.6 Plus
3R 31820162 3R 2111785..2112347 1418..858 2465 96.4 Minus
3R 31820162 3R 2106809..2107371 1418..858 2465 96.4 Minus
3R 31820162 3R 2857530..2858071 1972..1431 2455 97.4 Minus
4 1331231 4 1242318..1242855 1970..1431 2455 97.5 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 12628..13176 872..1418 2455 97 Plus
3L 28103327 3L 24014993..24015535 1431..1973 2445 97.2 Plus
2R 25260384 2R 3494527..3495068 1431..1972 2440 97.2 Plus
2R 25260384 2R 1065937..1066478 1972..1431 2440 97.2 Minus
3R 31820162 3R 8635759..8636294 1970..1435 2440 97.5 Minus
3R 31820162 3R 1130134..1130675 1972..1431 2440 97.2 Minus
2L 23513712 2L 23451433..23451970 1431..1970 2440 97.4 Plus
2R 25260384 2R 1531769..1532308 1970..1431 2430 97.2 Minus
2R 25260384 2R 1524876..1525417 1431..1972 2425 97 Plus
2R 25260384 2R 1527979..1528520 1972..1431 2425 97 Minus
Y 3410481 Y 1214291..1214833 1434..1977 2425 97.2 Plus
3L 28103327 3L 27731162..27731704 1431..1973 2415 96.8 Plus
3L 28103327 3L 24449354..24449909 865..1418 2415 96.2 Plus
3L 28103327 3L 24908210..24908749 1970..1431 2415 97 Minus
2R 25260384 2R 1066489..1067044 1418..865 2415 96.2 Minus
3L 28103327 3L 26562372..26562913 1431..1972 2410 96.8 Plus
3R 31820162 3R 3543884..3544425 1431..1972 2410 96.8 Plus
Y 3410481 Y 1504716..1505273 1418..863 2410 96 Minus
4 1331231 4 307197..307738 1431..1972 2410 96.8 Plus
4 1331231 4 457322..457865 1431..1973 2410 96.5 Plus
2R 25260384 2R 1512306..1512849 1431..1974 2405 96.6 Plus
3R 31820162 3R 9439..9981 1427..1970 2405 96.6 Plus
3R 31820162 3R 967827..968389 1418..858 2405 95.7 Minus
3L 28103327 3L 26801533..26802088 1418..865 2400 96 Minus
2R 25260384 2R 2586652..2587193 1431..1971 2400 96.4 Plus
3R 31820162 3R 218887..219429 1431..1973 2400 96.6 Plus
3R 31820162 3R 216794..217336 1431..1973 2400 96.6 Plus
3R 31820162 3R 3114674..3115203 1973..1445 2400 97.7 Minus
4 1331231 4 456756..457311 865..1418 2400 96 Plus
3L 28103327 3L 27124560..27125099 1971..1431 2395 97 Minus
3L 28103327 3L 24908760..24909314 1418..866 2395 96 Minus
3L 28103327 3L 23640630..23641184 1418..866 2395 96 Minus
2R 25260384 2R 5016535..5017092 1418..863 2395 95.8 Minus
2R 25260384 2R 1588522..1589061 1431..1970 2385 96.6 Plus
Y 3410481 Y 2194957..2195512 865..1418 2385 95.8 Plus
2L 23513712 2L 22338962..22339517 1418..865 2385 95.8 Minus
X 23527363 X 10109909..10110434 1973..1447 2385 97.1 Minus
3L 28103327 3L 27730597..27731151 866..1418 2380 95.8 Plus
2L 23513712 2L 16280863..16281426 1418..857 2380 95.3 Minus
3L 28103327 3L 24273612..24274160 866..1413 2375 96.3 Plus
3R 31820162 3R 331397..331951 865..1418 2375 96 Plus
4 1331231 4 432654..433191 1435..1972 2375 96.6 Plus
2R 25260384 2R 1511740..1512295 865..1418 2370 95.6 Plus
3R 31820162 3R 360781..361320 1431..1970 2370 96.4 Plus
2R 25260384 2R 1532319..1532873 1418..866 2365 95.6 Minus
3R 31820162 3R 3693451..3694005 866..1418 2365 95.6 Plus
3R 31820162 3R 3543319..3543873 866..1418 2365 95.6 Plus
3R 31820162 3R 2561325..2561879 1418..866 2365 95.6 Minus
2R 25260384 2R 14499193..14499748 1418..866 2360 95.8 Minus
Y 3410481 Y 1593962..1594503 1431..1973 2360 96.5 Plus
3L 28103327 3L 26788195..26788750 865..1418 2355 95.5 Plus
3L 28103327 3L 27052593..27053148 1418..865 2355 95.5 Minus
3L 28103327 3L 26604047..26604602 1418..865 2355 95.5 Minus
2R 25260384 2R 2586086..2586641 865..1418 2355 95.5 Plus
3R 31820162 3R 2007210..2007765 1418..865 2355 95.5 Minus
2L 23513712 2L 22629824..22630359 1972..1435 2355 96.4 Minus
3L 28103327 3L 23174228..23174769 1431..1972 2350 96.1 Plus
2R 25260384 2R 10007105..10007659 866..1418 2350 95.4 Plus
2R 25260384 2R 1587957..1588511 866..1418 2350 95.4 Plus
2R 25260384 2R 4697729..4698285 865..1418 2350 95.6 Plus
2R 25260384 2R 4214887..4215441 1418..866 2350 95.4 Minus
3R 31820162 3R 2556898..2557452 1418..866 2350 95.4 Minus
2L 23513712 2L 22338411..22338951 1970..1431 2350 96.4 Minus
4 1331231 4 454066..454620 866..1418 2350 95.4 Plus
4 1331231 4 303233..303774 1431..1973 2345 96.3 Plus
3L 28103327 3L 25591402..25591941 1970..1431 2340 96.1 Minus
3L 28103327 3L 23689731..23690279 1979..1431 2340 95.6 Minus
2R 25260384 2R 5015985..5016524 1970..1431 2340 96.6 Minus
4 1331231 4 183174..183727 1418..866 2340 95.6 Minus
3L 28103327 3L 23128441..23128995 866..1418 2335 95.3 Plus
3R 31820162 3R 208996..209539 1431..1973 2335 96.1 Plus
3R 31820162 3R 2687403..2687957 1418..866 2335 95.3 Minus
Y 3410481 Y 1153608..1154173 857..1418 2335 95 Plus
Y 3410481 Y 1146474..1147039 857..1418 2335 95 Plus
3L 28103327 3L 23520181..23520733 1418..866 2330 95.8 Minus
3L 28103327 3L 24279793..24280348 1418..865 2325 95.1 Minus
2L 23513712 2L 23171476..23172015 1431..1970 2325 95.9 Plus
2R 25260384 2R 4751598..4752152 866..1418 2320 95.1 Plus
3R 31820162 3R 2740917..2741471 866..1418 2320 95.1 Plus
3R 31820162 3R 768342..768896 866..1418 2320 95.1 Plus
3R 31820162 3R 4279765..4280300 1970..1435 2320 96.6 Minus
Y 3410481 Y 1154184..1154731 1431..1977 2320 95.4 Plus
Y 3410481 Y 1147050..1147597 1431..1977 2320 95.4 Plus
2R 25260384 2R 1228700..1229253 1418..865 2315 95.3 Minus
3R 31820162 3R 1192788..1193342 865..1418 2315 95.3 Plus
3L 28103327 3L 1485764..1486319 865..1418 2310 94.9 Plus
3R 31820162 3R 854669..855224 865..1418 2310 94.9 Plus
3L 28103327 3L 24970505..24971040 1970..1435 2305 95.9 Minus
3L 28103327 3L 23640081..23640619 1973..1431 2305 96.1 Minus
Y 3410481 Y 1504164..1504705 1972..1431 2305 95.5 Minus
Y 3410481 Y 1456375..1456929 1418..866 2305 94.9 Minus
3L 28103327 3L 26788761..26789301 1431..1973 2300 95.7 Plus
3L 28103327 3L 24513726..24514277 865..1418 2300 95.1 Plus
3R 31820162 3R 2106255..2106798 1974..1431 2300 95.4 Minus
3L 28103327 3L 15078206..15078761 865..1418 2295 94.7 Plus
3L 28103327 3L 27349849..27350404 1418..865 2295 94.7 Minus
2R 25260384 2R 3062718..3063273 1418..865 2295 94.7 Minus
3R 31820162 3R 2247473..2248028 865..1418 2295 94.7 Plus
X 23527363 X 22423969..22424524 865..1418 2295 94.7 Plus
2R 25260384 2R 552811..553365 866..1418 2290 94.7 Plus
3R 31820162 3R 3250089..3250643 1418..866 2290 94.7 Minus
Y 3410481 Y 3090774..3091312 1434..1972 2290 95.5 Plus
Y 3410481 Y 3240244..3240800 1418..866 2290 94.9 Minus
2R 25260384 2R 3636403..3636945 1431..1972 2285 95.5 Plus
Y 3410481 Y 1607051..1607602 871..1418 2285 95.4 Plus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 39754..40307 1418..865 2285 94.9 Minus
2R 25260384 2R 2945331..2945870 1972..1433 2280 95.3 Minus
Y 3410481 Y 2747832..2748373 1971..1431 2280 95.5 Minus
2L 23513712 2L 17336154..17336709 1418..865 2280 94.6 Minus
2R 25260384 2R 4214334..4214876 1973..1431 2275 95.9 Minus
3R 31820162 3R 30559696..30560253 863..1418 2275 94.4 Plus
4 1331231 4 932291..932850 1418..865 2275 94.6 Minus
3L 28103327 3L 24921974..24922524 1418..865 2270 94.7 Minus
2R 25260384 2R 2831719..2832251 1393..863 2270 95.6 Minus
3R 31820162 3R 23256962..23257520 1418..866 2270 94.6 Minus
Y 3410481 Y 3239691..3240233 1970..1431 2270 95.4 Minus
Y 3410481 Y 2748384..2748938 1418..865 2270 94.7 Minus
4 1331231 4 1176573..1177097 1970..1441 2270 96.4 Minus
2R 25260384 2R 2805316..2805871 865..1418 2265 94.4 Plus
3L 28103327 3L 24369672..24370202 865..1393 2260 95.6 Plus
2R 25260384 2R 1423540..1424094 864..1418 2260 94.6 Plus
2R 25260384 2R 8567287..8567843 865..1418 2260 94.6 Plus
2R 25260384 2R 14498641..14499182 1972..1431 2260 95 Minus
Y 3410481 Y 2088789..2089339 1418..865 2260 94.9 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 13190..13728 1434..1972 2260 95.7 Plus
2R 25260384 2R 2006417..2006974 866..1418 2255 94.8 Plus
3R 31820162 3R 1913995..1914548 1418..865 2255 94.6 Minus
2L 23513712 2L 21401545..21402069 870..1393 2255 96.1 Plus
3R 31820162 3R 8636301..8636854 1418..866 2250 94.5 Minus
3L 28103327 3L 25070946..25071476 1393..865 2245 95.4 Minus
2R 25260384 2R 811228..811769 1431..1972 2245 94.8 Plus
3R 31820162 3R 469370..469923 1418..866 2245 94.7 Minus
3R 31820162 3R 1908048..1908602 1418..866 2245 94.2 Minus
2L 23513712 2L 22841322..22841863 1972..1431 2245 94.8 Minus
3L 28103327 3L 23574994..23575529 1971..1431 2240 95.7 Minus
2R 25260384 2R 5402920..5403474 865..1418 2240 94.4 Plus
2L 23513712 2L 22630423..22630952 1393..866 2240 95.4 Minus
2R 25260384 2R 318877..319437 864..1418 2235 94.1 Plus
Y 3410481 Y 2195529..2196062 1437..1970 2235 95.1 Plus
2L 23513712 2L 23318826..23319351 865..1388 2235 95.6 Plus
X 23527363 X 2673070..2673625 1418..866 2235 94.6 Minus
3L 28103327 3L 25867643..25868202 865..1418 2230 94.1 Plus
2R 25260384 2R 1632575..1633103 1393..866 2230 95.6 Minus
4 1331231 4 432031..432585 866..1418 2230 94 Plus
3L 28103327 3L 27125110..27125654 1418..866 2225 94.5 Minus
2R 25260384 2R 601846..602404 866..1418 2225 94 Plus
3L 28103327 3L 24449920..24450459 1431..1970 2220 94.6 Plus
4 1331231 4 306633..307143 865..1373 2220 96.2 Plus
4 1331231 4 295180..295728 1418..866 2220 94.2 Minus
2R 25260384 2R 4624209..4624742 1970..1431 2215 95.1 Minus
2L 23513712 2L 23185005..23185564 865..1418 2215 93.9 Plus
Y 3410481 Y 1455822..1456364 1972..1431 2210 94.6 Minus
2L 23513712 2L 22967028..22967547 876..1393 2205 95.5 Plus
3L 28103327 3L 24464529..24465069 1431..1970 2200 94.6 Plus
3L 28103327 3L 24496834..24497362 865..1390 2195 95.2 Plus
3L 28103327 3L 15078772..15079314 1431..1972 2195 94.4 Plus
3L 28103327 3L 27052041..27052582 1973..1431 2195 94.4 Minus
3L 28103327 3L 26603495..26604036 1973..1431 2195 94.4 Minus
3L 28103327 3L 23643522..23644026 916..1418 2190 96.2 Plus
3L 28103327 3L 25796292..25796823 1971..1435 2185 94.9 Minus
3L 28103327 3L 24279242..24279782 1970..1431 2185 94.4 Minus
2R 25260384 2R 1106580..1107117 1431..1967 2185 94.6 Plus
3L 28103327 3L 24514288..24514830 1431..1972 2180 94.3 Plus
2R 25260384 2R 1095262..1095804 1431..1972 2180 94.3 Plus
2R 25260384 2R 2979721..2980255 1431..1971 2175 94.6 Plus
2R 25260384 2R 1410241..1410795 1418..865 2175 93.8 Minus
2L 23513712 2L 17335603..17336143 1970..1431 2170 94.2 Minus
2L 23513712 2L 22549602..22550131 1393..866 2165 94.5 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 29280..29818 1973..1434 2165 94.2 Minus
2R 25260384 2R 3171698..3172231 1431..1970 2160 94.2 Plus
2R 25260384 2R 1078186..1078718 1972..1435 2160 94.6 Minus
4 1331231 4 907952..908456 916..1418 2160 95.8 Plus
4 1331231 4 294683..295169 1918..1431 2160 97.1 Minus
4 1331231 4 302674..303183 866..1373 2155 95.4 Plus
4 1331231 4 33824..34378 866..1418 2155 93.1 Plus
4 1331231 4 1258735..1259275 1970..1431 2155 94 Minus
2R 25260384 2R 3903259..3903781 865..1387 2145 94.8 Plus
2L 23513712 2L 23189440..23189953 870..1381 2145 95.1 Plus
X 23527363 X 22034704..22035257 865..1418 2140 93.5 Plus
X 23527363 X 22070921..22071474 865..1418 2140 93.5 Plus
X 23527363 X 10110435..10110918 1346..865 2130 96.6 Minus
4 1331231 4 25706..26235 1393..865 2100 93.9 Minus
2L 23513712 2L 19737410..19737963 865..1418 2095 92.9 Plus
Y 3410481 Y 1571952..1572452 1418..916 2090 95.2 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 39202..39740 1970..1434 2085 93.3 Minus
Y 3410481 Y 2886771..2887256 1374..891 2080 95.8 Minus
Y 3410481 Y 2879488..2879973 1374..891 2080 95.8 Minus
4 1331231 4 1167771..1168320 865..1418 2080 92.8 Plus
Y 3410481 Y 2871089..2871594 1418..916 2065 94.8 Minus
4 1331231 4 53466..53997 1393..865 2050 93.8 Minus
Y 3410481 Y 651235..651708 1418..947 2020 95.7 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 34356..34894 1970..1434 2010 92.4 Minus
2L 23513712 2L 23283657..23284115 1514..1972 1995 96.3 Plus
Y 3410481 Y 1570278..1570782 916..1418 1990 94 Plus
4 1331231 4 1177096..1177564 1382..916 1980 96.1 Minus
4 1331231 4 1259286..1259764 1418..942 1970 94.7 Minus
4 1331231 4 1168419..1168904 1486..1971 1965 94.2 Plus
4 1331231 4 1241195..1241685 865..1353 1955 93.8 Plus
4 1331231 4 934588..935078 865..1353 1955 93.8 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 88644..89145 1418..916 1945 93.6 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 41179..41680 1418..916 1945 93.6 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 38317..38818 1418..916 1945 93.6 Minus
Y 3410481 Y 595666..596131 955..1418 1935 95 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 103126..103627 1418..916 1930 93.4 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 32611..33112 1418..916 1930 93.4 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 29728..30229 1418..916 1930 93.4 Minus
Y 3410481 Y 1588070..1588579 866..1376 1925 92.9 Plus
X 23527363 X 21960952..21961393 979..1418 1920 96.3 Plus
2L 23513712 2L 23257434..23257888 1514..1972 1895 95.2 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 21087..21594 1418..916 1860 92.5 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 49438..49945 1418..916 1845 92.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 15624..16131 1418..916 1845 92.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 12771..13278 1418..916 1845 92.3 Minus
2L 23513712 2L 22405640..22406101 957..1418 1830 94.3 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 60573..61080 1418..916 1830 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 57704..58211 1418..916 1830 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 54835..55342 1418..916 1830 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 46911..47418 1418..916 1830 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 44042..44549 1418..916 1830 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 9917..10424 1418..916 1830 92.1 Minus
Y 3410481 Y 1647323..1647823 1376..874 1825 92 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 18219..18726 1418..916 1815 91.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 135821..136349 1397..866 1815 91.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 51965..52473 1418..916 1810 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 96862..97368 1418..916 1805 92.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 65916..66422 1418..916 1805 92.1 Minus
Y 3410481 Y 1697140..1697637 916..1418 1800 92 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 24010..24471 1378..916 1790 93.7 Minus
Y 3410481 Y 1615099..1615597 1418..916 1785 91.8 Minus
Y 3410481 Y 2250501..2250901 1488..1888 1780 97 Plus
Y 3410481 Y 2136233..2136633 1488..1888 1780 97 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 26885..27346 1378..916 1775 93.5 Minus
Y 3410481 Y 1550063..1550537 1418..942 1760 92.9 Minus
Y 3410481 Y 2189831..2190251 996..1414 1755 95.2 Plus
Y 3410481 Y 2088274..2088707 1971..1539 1730 94.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 91547..92026 1397..916 1695 91.7 Minus
4 1331231 4 955249..955659 1010..1418 1675 94.6 Plus
X 23527363 X 21761792..21762224 1418..986 1655 93.5 Minus
Y 3410481 Y 1569116..1569588 942..1418 1645 91.6 Plus
2L 23513712 2L 22967745..22968115 1602..1972 1630 96.7 Plus
4 1331231 4 41520..41969 915..1362 1630 91.5 Plus
Y 3410481 Y 828937..829340 1017..1418 1625 94.3 Plus
Y 3410481 Y 1613690..1614121 942..1375 1620 93.3 Plus
4 1331231 4 613005..613429 1294..865 1610 93 Minus
Y 3410481 Y 596280..596650 1602..1972 1600 96.2 Plus
2L 23513712 2L 23328398..23328821 997..1418 1590 93.1 Plus
4 1331231 4 25134..25502 1970..1602 1590 96.2 Minus
Y 3410481 Y 1601548..1601968 916..1337 1570 92.9 Plus
Y 3410481 Y 1581511..1581939 988..1418 1560 92.6 Plus
2L 23513712 2L 21571925..21572310 1035..1418 1550 94.3 Plus
2L 23513712 2L 22586657..22587044 865..1251 1540 94.3 Plus
2L 23513712 2L 23447248..23447657 1972..1559 1535 92.5 Minus
Y 3410481 Y 829523..829908 1588..1972 1530 94.3 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 133274..133678 1321..916 1520 93.1 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 25158..25560 1342..941 1510 92.8 Minus
2L 23513712 2L 22565149..22565535 1251..866 1505 93.8 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 77312..77704 1418..1025 1505 93.6 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 35473..35865 1418..1025 1505 93.6 Minus
2L 23513712 2L 22251904..22252272 1602..1972 1500 94.8 Plus
Y 3410481 Y 2872747..2873095 1496..1842 1495 96.5 Plus
4 1331231 4 908643..908994 1621..1972 1475 95.4 Plus
2L 23513712 2L 23319353..23319684 1502..1834 1460 96.3 Plus
Y 3410481 Y 861800..862170 1894..1527 1455 94 Minus
4 1331231 4 858503..858854 1621..1970 1455 95.1 Plus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 29870..30216 1254..910 1430 95.1 Minus
4 1331231 4 1243059..1243407 1211..865 1425 94.8 Minus
X 23527363 X 2672537..2672844 1973..1666 1420 97.4 Minus
2L 23513712 2L 23450885..23451233 865..1211 1410 94.5 Plus
4 1331231 4 182694..183064 1804..1435 1410 93.2 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 156204..156578 1238..866 1405 92.5 Minus
2L 23513712 2L 21572533..21572891 1391..1035 1385 93.3 Minus
X 23527363 X 23379748..23380094 1972..1628 1370 93.9 Minus
2L 23513712 2L 22548963..22549311 1974..1628 1365 93.6 Minus
2L 23513712 2L 19740474..19740819 1628..1970 1365 93.9 Plus
2L 23513712 2L 23191006..23191353 1628..1973 1360 93.6 Plus
2L 23513712 2L 23186146..23186493 1628..1973 1360 93.6 Plus
4 1331231 4 788962..789309 1973..1628 1345 93.3 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 34908..35252 1418..1074 1345 93.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 7199..7555 1273..916 1325 93 Minus
4 1331231 4 34950..35294 1628..1971 1325 92.7 Plus
X 23527363 X 12779347..12779658 1602..1913 1320 95.8 Plus
4 1331231 4 931745..932060 1973..1659 1315 94.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 85817..86163 1418..1071 1305 93.4 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 82977..83323 1418..1071 1305 93.4 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 80145..80491 1418..1071 1305 93.4 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 94020..94366 1418..1071 1290 93.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 68783..69129 1418..1071 1290 93.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 63074..63420 1418..1071 1290 93.1 Minus
X 23527363 X 22374370..22374647 1142..1418 1290 98.2 Plus
2L 23513712 2L 23283360..23283630 1149..1418 1285 98.8 Plus
2L 23513712 2L 23257137..23257407 1149..1418 1285 98.8 Plus
2L 23513712 2L 23450005..23450315 1174..865 1275 94.5 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 99729..100075 1418..1071 1275 92.8 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 71622..71968 1418..1071 1275 92.8 Minus
X 23527363 X 22379666..22379943 1142..1418 1275 97.8 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 76661..76976 1970..1656 1270 93.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 20448..20763 1970..1656 1270 93.9 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 74461..74807 1418..1071 1260 92.5 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 34834..35149 1970..1656 1255 93.6 Minus
4 1331231 4 955888..956200 1659..1970 1255 93.9 Plus
2L 23513712 2L 22842111..22842418 1171..865 1245 94.1 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 82338..82653 1970..1656 1240 93.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 79506..79821 1970..1656 1240 93.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 26201..26516 1970..1656 1240 93.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 90866..91181 1970..1656 1240 93.3 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 85178..85493 1970..1656 1240 93.3 Minus
2L 23513712 2L 21583183..21583447 1709..1973 1235 97.7 Plus
4 1331231 4 367574..367914 1203..865 1235 91.7 Minus
4 1331231 4 1259829..1260092 1709..1972 1230 97.7 Plus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 132635..132950 1970..1656 1225 93 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 99090..99405 1970..1656 1225 93 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 96230..96545 1970..1656 1225 93 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 73822..74137 1970..1656 1225 93 Minus
Unmapped_scaffold_03 170808 Unmapped_scaffold_03 70983..71298 1970..1656 1225 93 Minus
2L 23513712 2L 23256859..23257138 865..1143 1210 96 Plus
2L 23513712 2L 23283082..23283361 865..1143 1210 96 Plus
2L 23513712 2L 23272664..23272943 865..1143 1210 96 Plus
2L 23513712 2L 23171194..23171465 1149..1418 1205 97.4 Plus
2L 23513712 2L 22263132..22263404 1972..1700 1200 95.9 Minus
4 1331231 4 612550..612878 1766..1435 1200 93.1 Minus
X 23527363 X 23384520..23384810 1310..1022 1180 94.8 Minus
4 1331231 4 858053..858316 1156..1418 1145 96.2 Plus
4 1331231 4 857743..858031 865..1152 1135 93.4 Plus
X 23527363 X 21961719..21961989 1706..1977 1095 94.1 Plus
X 23527363 X 22380204..22380469 1645..1908 1065 93.9 Plus
X 23527363 X 22374908..22375173 1645..1908 1065 93.9 Plus
4 1331231 4 52953..53204 1898..1649 995 93.6 Minus
4 1331231 4 454689..454947 1435..1698 970 93.5 Plus
4 1331231 4 1241891..1242124 1602..1835 945 94.8 Plus
4 1331231 4 935284..935516 1602..1835 930 94.4 Plus
4 1331231 4 961030..961278 1721..1969 930 91.5 Plus
X 23527363 X 2672849..2673059 1642..1431 915 96.2 Minus
X 23527363 X 22035726..22035935 1761..1970 900 95.2 Plus
X 23527363 X 22380012..22380201 1435..1624 890 97.8 Plus
X 23527363 X 22374716..22374905 1435..1624 890 97.8 Plus
X 23527363 X 21761104..21761313 1970..1761 885 94.7 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 19575..19842 1916..1650 880 89.1 Minus
4 1331231 4 955670..955887 1431..1647 865 94.5 Plus
X 23527363 X 22705922..22706173 1721..1972 855 89.2 Plus
X 23527363 X 22713253..22713569 865..1180 810 85.2 Plus
X 23527363 X 22424684..22424878 1628..1820 745 93.8 Plus
X 23527363 X 21761322..21761534 1734..1524 735 91.1 Minus
X 23527363 X 21960498..21960671 863..1037 730 95.4 Plus
X 23527363 X 21960669..21960844 861..1037 725 94.9 Plus
X 23527363 X 1522288..1522473 866..1051 720 92.4 Plus
X 23527363 X 23388545..23388721 1033..857 720 93.7 Minus
X 23527363 X 22035508..22035717 1526..1734 710 91.4 Plus
X 23527363 X 18139675..18139873 1312..1113 700 93 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 4672..4845 874..1047 660 91.9 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 24554..24721 1970..1803 660 92.8 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 35283..35427 1054..910 635 95.8 Minus
X 23527363 X 22379520..22379658 968..1106 620 96.4 Plus
X 23527363 X 22374224..22374362 968..1106 620 96.4 Plus
X 23527363 X 21018450..21018591 866..1007 620 95.7 Plus
X 23527363 X 18139886..18140102 1080..865 610 86.1 Minus
X 23527363 X 21961404..21961551 1431..1579 600 94.6 Plus
X 23527363 X 12779213..12779343 1435..1565 595 96.9 Plus
X 23527363 X 6765390..6765538 883..1031 580 92.6 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 11573..11709 874..1010 565 94.1 Plus
X 23527363 X 21961573..21961719 1554..1699 540 93.2 Plus
X 23527363 X 21018587..21018733 1028..1173 530 91.8 Plus
X 23527363 X 22697596..22697792 1116..922 510 84.7 Minus
X 23527363 X 21960842..21960960 861..979 505 94.9 Plus
X 23527363 X 22005736..22005874 1202..1341 495 91.4 Plus
X 23527363 X 22042163..22042301 1202..1341 495 91.4 Plus
X 23527363 X 23383648..23383764 1418..1302 495 94.8 Minus
X 23527363 X 22871461..22871604 1221..1365 475 89.6 Plus
X 23527363 X 22179039..22179178 1074..1211 455 90.7 Plus
X 23527363 X 22169259..22169398 1074..1211 455 90.7 Plus
X 23527363 X 22159407..22159546 1074..1211 455 90.7 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 11863..11962 1224..1323 350 90 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 4974..5073 1224..1323 350 90 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 24723..24795 1793..1721 275 91.7 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 11742..11821 1063..1141 270 91.2 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 4853..4932 1063..1141 270 91.2 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 12356..12412 1744..1800 240 94.7 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 12166..12213 1435..1482 210 95.8 Plus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 48318..48369 1919..1970 200 92.3 Plus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 24915..24955 1475..1435 175 95.1 Minus
Unmapped_scaffold_09 66731 Unmapped_scaffold_09 25106..25145 1418..1379 170 95 Minus
Unmapped_scaffold_04 86267 Unmapped_scaffold_04 29832..29866 1418..1384 145 94.2 Minus
Blast to na_te.dros performed 2014-11-27 03:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 1..710 866..1568 2450 84.8 Plus
1360 3409 1360 1360 3409bp 2827..3409 1428..1970 1615 78.1 Plus
1360 3409 1360 1360 3409bp 1..50 1970..1920 180 86.3 Minus
1360 3409 1360 1360 3409bp 3359..3409 915..866 162 82.4 Minus
1360 3409 1360 1360 3409bp 503..542 1406..1367 146 85 Minus

IP18173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:05:20 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1650007..1650105 1..99 100   Minus
chr3R 1649188..1649953 100..865 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:37 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 1..684 19..702 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:48 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 1..684 19..702 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:28:06 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 1..684 19..702 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:10:08 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 1..684 19..702 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:20 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RB 1..684 19..702 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:07 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:31:17 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 46..747 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:48 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 46..922 1..877 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:06 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 46..2426 1..2379 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:10:08 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 46..747 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:20 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 46..2426 1..2379 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:05:20 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824361..5824459 1..99 100   Minus
3R 5822026..5824307 100..2379 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:06 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1650083..1650181 1..99 100   Minus
arm_3R 1647748..1650029 100..2379 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:00 Download gff for IP18173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5565192..5565290 1..99 100   Minus
3R 5562857..5565138 100..2379 99 <- Minus

IP18173.hyp Sequence

Translation from 0 to 701

> IP18173.hyp
QNKVGDMDKDAFTLQAIRQDLIDNNLQAKAIIHDILNSRTSIAELEELNE
AGRSKLSAIRKSIERLDDWARDTADSALANEVDDHRDQFSKTLQAFRKAN
VSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQENDVTEKM
LAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLK
KYGRRECTDKMLLFFAFSLFLACVFYIVQKRLF*

IP18173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-PA 227 CG2023-PA 1..227 7..233 1119 100 Plus
CG2023-PB 227 CG2023-PB 1..227 7..233 1119 100 Plus

IP18173.pep Sequence

Translation from 18 to 701

> IP18173.pep
MDKDAFTLQAIRQDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKL
SAIRKSIERLDDWARDTADSALANEVDDHRDQFSKTLQAFRKANVSTMLE
IEKANREELMAITGESELRQRTTTRARHNQGSLVSQENDVTEKMLAISRH
LSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRE
CTDKMLLFFAFSLFLACVFYIVQKRLF*

IP18173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18643-PA 227 GF18643-PA 1..227 1..227 1044 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10798-PA 227 GG10798-PA 1..227 1..227 1060 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18355-PA 227 GH18355-PA 1..227 1..227 969 87.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-PA 227 CG2023-PA 1..227 1..227 1119 100 Plus
CG2023-PB 227 CG2023-PB 1..227 1..227 1119 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10780-PA 227 GI10780-PA 1..227 1..227 982 89 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23215-PA 227 GL23215-PA 1..227 1..227 1096 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15191-PA 227 GA15191-PA 1..227 1..227 1103 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10587-PA 227 GM10587-PA 1..227 1..227 1081 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19577-PA 227 GD19577-PA 1..227 1..227 1091 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14379-PA 227 GJ14379-PA 1..227 1..227 992 89.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11703-PA 227 GK11703-PA 1..227 1..227 998 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24133-PA 227 GE24133-PA 1..227 1..227 989 93 Plus