Clone IP19154 Report

Search the DGRC for IP19154

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:191
Well:54
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG4009-RB
Protein status:IP19154.pep: gold
Sequenced Size:2111

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4009 2008-04-29 Picked prior to 5.5
CG4009 2008-05-05 Release 5.5 slip selected
CG4009 2008-12-18 5.12 accounting

Clone Sequence Records

IP19154.complete Sequence

2111 bp assembled on 2008-08-28

GenBank Submission: BT044462.1

> IP19154.complete
ATTGTGCTTTGTGGTGTCGTCGGTGCTATGAGAGTGTTTTTGGTGGTGTT
GAGTGTGCTGTCTGTGGCGGTGGCCACCAAGTGTCCGTATTCGGCAATGG
AACCCTCCTTGTCCAGGTCCAAACGGAGTTCTTTTGATATTCGCCCAGGA
GTTAGTGACGGAAGTTTGGATGCCTTGATTAAAGAATTTATGCCCAAGTA
CAATGGCAACAATGTTCACAATAGTTGGGCCGAGCCTTCTGCCTCCCAAC
AACCTTTAAGATGTGGAGTTCCGCCTCGCAACTGCTTGAATGATACTCGA
AATCTGCACTACCGAACCTTGGATGGATCATGCAACAATCTGTTGTATCC
GGAGTTTGGAATTGCCGTTTCGCGCTATCGTAGGCTTTTGCCTCCTCGCC
AAGTGGAACAGGCTCCGAATGCCCGTTTGATCTCCTTGTCGCTGTACGGC
GAGCAGACGAGGAACGATAGGTTCCGCACCATGGCGGCCATGCAATGGGG
CCAGTTTGTTGCCCACGATATCAGCCAATTGAGCACACAGGGCGCTCCTC
AAGATTGCTGTGCCGAGCCGCGTCATCCTCGCTGTCTGCCAATCAACCTG
CCCCGTGGTGGTCCCATCGCATACCATACGGGCAAGACCTGTCTGCACTT
TGCACGCAGTGTGTCGGATGCGGATGCCATATGCCCAAAGGTTGAGGAAC
CCCAACCGGAGAAGCTAACGGTGGCAACTGCTTACCTGGATCTCTCCTCC
ATCTATGGCAACAATCCCTCGCAAAACAGAAAGGTCCGCTTGTTCAAGGG
CGGACTTCTGAAGACCAGCTACACGAACGGACAACACTGGCTACCGGTGA
GCCAAAATGAGAATGGCGAGTGCGGTGCCAAGAGTGAGTGCTACATCGTA
CCGGACATTCGGAATCGTTTCTCGCCCACCATCGCCCTATTGCAGACTCT
GTTGGTCCGAGAGCACAATCGTCTGGCCGAAAATCTAGCGCTGATTAATC
CCGATCATAGTGACGAGCGCATCTTCCAGGAGGCACGCAAGATTAACATT
GCGCAGTTCCAGAAGATCACATACTATGACTGGCTTCCACTGTTCGTTGG
TCGCACCTATACCTACTTGAACGGACTGATTTATCCAGTGGAGCCCACCG
AGTATGTCAACGACTACGACGAGACGGTTAATCCTGCTGCCTATGCGGAG
TTTTCTGCTGCCGCCTTTAGATACGCCCACACCCAAATCCCCGGATGGTT
TTCATTGGTTGCCCCCAATCGGAGATCTAATAGAACCATGCGCCTGAGCG
ACTTCCTCGACCGTACAGAGACTATTCGTTTACTGGACACATCCGACAAC
TTCGATGCCCTGTTGAGAGGCTTGGCTACCCAGTTGCACAAGCGATCGGA
TGGGAACATTGATCGGGAGATCAAGCACTACTTCAACCGCAAGGAGTTCG
AGGAATACGGTTCGGATCTGAAGTCTATAGATATTCAGAGGGCACGAGAC
TTCGGATTGGCTTCCTACAACGATGTGCGAGAGTTTTGTGGTCTGCGACG
AGCTGTCGATTGGGCGGATTTCGCTCACGAAATTCCCGGAGAGAAAATAT
CGCTGTTGCGCCGACTGTACGCCACTCCGGATGACGTGGAACTTGGTGTT
GGCGGTACCTTGGAGTACCATGTCCCAGATGCTCTATTCGGACCAACTTT
GTTGTGTGTGATTGGAAAACAGTTCCTTAACACGCGACGTGGCGATAGAT
TCTTCTTTGAGCGGGAGAACGAAGGAGGTTTTTCGCGCGCTCAATTGGCC
GAGATCCGGAAAGTGAGCCTGTCCAGCTTGTTCTGCAGCAATGCCAACTA
TCTGCATTTAATCCAGCCAAACGTATTTGTCTTCCCGAATTCACATAATC
TACTACTGAACTGCAATTTTATTCCTCAAATCGATCTAAGCAAATGGCAG
GATCTCAGGCCTCAGCTTGTTCACTAGTGTTTTTGCTAGCAAATGTATCT
GAAACTAATTGAACTGCTCAATTTGTTCTTTAAGATGCAAACATTTTTGT
TTAGTTACATTTTTATCATTTTGGGAAAGAAGAAAGAAAAAAAAAGAAAA
AAAAAAAAAAA

IP19154.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009.a 2291 CG4009.a 90..2178 1..2089 10445 100 Plus
CG4009-RA 1872 CG4009-RA 1..1868 28..1895 9340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12859269..12860518 1250..1 6235 99.9 Minus
chr3R 27901430 chr3R 12858867..12859206 1593..1254 1625 98.5 Minus
chr3R 27901430 chr3R 12858616..12858813 1789..1592 990 100 Minus
chr3R 27901430 chr3R 12858195..12858388 2089..1896 970 100 Minus
chr3R 27901430 chr3R 12858447..12858553 1895..1789 535 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-RC 1950 CG4009-PC 1..1950 28..1977 9750 100 Plus
CG4009-RB 1950 CG4009-PB 1..1950 28..1977 9750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-RC 2214 CG4009-RC 1..2089 1..2089 10445 100 Plus
CG4009-RB 2086 CG4009-RB 1..2086 1..2086 10430 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-PC 649 CG4009-PC 1..649 28..1974 3199 100 Plus
CG4009-PB 649 CG4009-PB 1..649 28..1974 3199 100 Plus
Pxd-PC 688 CG3477-PC 91..673 262..1953 1103 42.1 Plus
Pxd-PB 690 CG3477-PB 93..675 262..1953 1103 42.1 Plus
Pxd-PA 690 CG3477-PA 93..675 262..1953 1103 42.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17034793..17036045 1253..1 6265 100 Minus
3R 32079331 3R 17034388..17034727 1593..1254 1700 100 Minus
3R 32079331 3R 17034134..17034331 1789..1592 990 100 Minus
3R 32079331 3R 17033713..17033906 2089..1896 970 100 Minus
3R 32079331 3R 17033965..17034071 1895..1789 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16775624..16776876 1253..1 6265 100 Minus
3R 31820162 3R 16775219..16775558 1593..1254 1700 100 Minus
3R 31820162 3R 16774965..16775162 1789..1592 990 100 Minus
3R 31820162 3R 16774544..16774737 2089..1896 970 100 Minus
3R 31820162 3R 16774796..16774902 1895..1789 535 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:00:19 has no hits.

IP19154.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:19:27 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12859266..12860518 1..1253 99   Minus
chr3R 12858867..12859206 1254..1593 98 <- Minus
chr3R 12858616..12858811 1594..1789 100 <- Minus
chr3R 12858447..12858552 1790..1895 100 <- Minus
chr3R 12858209..12858388 1896..2075 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:14:16 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RA 1..1872 28..1898 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:45 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 1..1950 28..1977 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:54:39 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 1..1950 28..1977 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:27 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 1..1950 28..1977 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:50:29 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RA 1..1872 28..1898 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:45 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 1..2075 1..2075 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:54:39 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RC 1..2075 1..2075 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:08:37 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RA 1..1872 28..1898 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:27 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RC 1..2075 1..2075 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:19:27 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17034793..17036045 1..1253 100   Minus
3R 17034388..17034727 1254..1593 100 <- Minus
3R 17034134..17034329 1594..1789 100 <- Minus
3R 17033965..17034070 1790..1895 100 <- Minus
3R 17033727..17033906 1896..2075 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:54:39 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12860515..12861767 1..1253 100   Minus
arm_3R 12860110..12860449 1254..1593 100 <- Minus
arm_3R 12859856..12860051 1594..1789 100 <- Minus
arm_3R 12859687..12859792 1790..1895 100 <- Minus
arm_3R 12859449..12859628 1896..2075 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:17 Download gff for IP19154.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16775624..16776876 1..1253 100   Minus
3R 16775219..16775558 1254..1593 100 <- Minus
3R 16774965..16775160 1594..1789 100 <- Minus
3R 16774796..16774901 1790..1895 100 <- Minus
3R 16774558..16774737 1896..2075 100 <- Minus

IP19154.pep Sequence

Translation from 0 to 1976

> IP19154.pep
IVLCGVVGAMRVFLVVLSVLSVAVATKCPYSAMEPSLSRSKRSSFDIRPG
VSDGSLDALIKEFMPKYNGNNVHNSWAEPSASQQPLRCGVPPRNCLNDTR
NLHYRTLDGSCNNLLYPEFGIAVSRYRRLLPPRQVEQAPNARLISLSLYG
EQTRNDRFRTMAAMQWGQFVAHDISQLSTQGAPQDCCAEPRHPRCLPINL
PRGGPIAYHTGKTCLHFARSVSDADAICPKVEEPQPEKLTVATAYLDLSS
IYGNNPSQNRKVRLFKGGLLKTSYTNGQHWLPVSQNENGECGAKSECYIV
PDIRNRFSPTIALLQTLLVREHNRLAENLALINPDHSDERIFQEARKINI
AQFQKITYYDWLPLFVGRTYTYLNGLIYPVEPTEYVNDYDETVNPAAYAE
FSAAAFRYAHTQIPGWFSLVAPNRRSNRTMRLSDFLDRTETIRLLDTSDN
FDALLRGLATQLHKRSDGNIDREIKHYFNRKEFEEYGSDLKSIDIQRARD
FGLASYNDVREFCGLRRAVDWADFAHEIPGEKISLLRRLYATPDDVELGV
GGTLEYHVPDALFGPTLLCVIGKQFLNTRRGDRFFFERENEGGFSRAQLA
EIRKVSLSSLFCSNANYLHLIQPNVFVFPNSHNLLLNCNFIPQIDLSKWQ
DLRPQLVH*

IP19154.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17914-PA 645 GF17914-PA 1..645 10..658 2884 82 Plus
Dana\GF17077-PA 695 GF17077-PA 88..683 76..654 1278 44.5 Plus
Dana\GF16408-PA 753 GF16408-PA 132..727 81..651 735 30.3 Plus
Dana\GF23081-PA 809 GF23081-PA 209..808 70..650 698 32.5 Plus
Dana\GF15059-PA 1393 GF15059-PA 715..1282 101..651 693 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16797-PA 622 GG16797-PA 1..622 10..632 3055 95 Plus
Dere\GG21906-PA 689 GG21906-PA 91..678 86..654 1234 42.9 Plus
Dere\GG22254-PA 753 GG22254-PA 132..728 81..652 741 30.9 Plus
Dere\GG21118-PA 1394 GG21118-PA 698..1283 81..651 708 32 Plus
Dere\GG22459-PA 809 GG22459-PA 226..808 91..650 700 33.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18067-PA 675 GH18067-PA 3..675 2..658 2311 63.6 Plus
Dgri\GH19555-PA 691 GH19555-PA 88..679 83..658 1248 42.5 Plus
Dgri\GH13532-PA 753 GH13532-PA 132..728 81..652 739 30.5 Plus
Dgri\GH11214-PA 1394 GH11214-PA 695..1283 81..651 704 32.4 Plus
Dgri\GH17282-PA 751 GH17282-PA 164..750 82..650 667 33 Plus
Dgri\GH11214-PA 1394 GH11214-PA 66..559 104..650 393 26.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-PC 649 CG4009-PC 1..649 10..658 3446 100 Plus
CG4009-PB 649 CG4009-PB 1..649 10..658 3446 100 Plus
Pxd-PC 688 CG3477-PC 91..673 88..651 1212 43.1 Plus
Pxd-PB 690 CG3477-PB 93..675 88..651 1212 43.1 Plus
Pxd-PA 690 CG3477-PA 93..675 88..651 1212 43.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23745-PA 672 GI23745-PA 1..672 10..658 2325 64.6 Plus
Dmoj\GI23851-PA 687 GI23851-PA 78..671 79..651 1257 43.6 Plus
Dmoj\GI24789-PA 753 GI24789-PA 132..731 81..655 737 30.6 Plus
Dmoj\GI14135-PA 1394 GI14135-PA 703..1283 88..651 707 32.4 Plus
Dmoj\GI23955-PA 714 GI23955-PA 145..713 102..650 688 33.7 Plus
Dmoj\GI14135-PA 1394 GI14135-PA 66..567 104..658 411 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22991-PA 606 GL22991-PA 11..605 14..630 2292 69 Plus
Dper\GL24545-PA 691 GL24545-PA 70..678 63..654 1253 43.1 Plus
Dper\GL23577-PA 774 GL23577-PA 153..749 81..652 738 30.5 Plus
Dper\GL13626-PA 716 GL13626-PA 7..562 104..654 631 32.3 Plus
Dper\GL23247-PA 832 GL23247-PA 215..792 101..653 588 30.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17852-PA 493 GA17852-PA 1..491 161..651 2162 82.3 Plus
Dpse\GA27312-PA 691 GA27312-PA 91..678 86..654 1247 43.9 Plus
Dpse\GA19195-PA 774 GA19195-PA 153..749 81..652 737 30.5 Plus
Dpse\GA10160-PA 1397 GA10160-PA 706..1286 88..651 707 32.4 Plus
Dpse\GA28057-PA 812 GA28057-PA 227..811 88..650 670 32.1 Plus
Dpse\GA10160-PA 1397 GA10160-PA 69..562 104..650 439 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15392-PA 684 GM15392-PA 53..684 1..632 3343 98.3 Plus
Dsec\GM15197-PA 703 GM15197-PA 91..691 86..654 1188 42 Plus
Dsec\GM15259-PA 809 GM15259-PA 226..808 91..650 704 33.2 Plus
Dsec\GM17279-PA 1394 GM17279-PA 699..1283 81..651 704 31.9 Plus
Dsec\GM26626-PA 1495 GM26626-PA 71..618 104..654 636 31.7 Plus
Dsec\GM17279-PA 1394 GM17279-PA 69..562 104..650 426 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20258-PA 710 GD20258-PA 53..710 1..658 3506 98.9 Plus
Dsim\GD19129-PA 717 GD19129-PA 110..705 76..654 1234 42.5 Plus
Dsim\GD19162-PA 753 GD19162-PA 132..728 81..652 740 30.9 Plus
Dsim\GD19183-PA 809 GD19183-PA 226..808 91..650 708 33.2 Plus
Dsim\GD24141-PA 1394 GD24141-PA 699..1283 81..651 704 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10592-PA 837 GJ10592-PA 1..654 10..631 2299 65 Plus
Dvir\GJ10566-PA 692 GJ10566-PA 92..676 86..651 1228 42.8 Plus
Dvir\GJ24437-PA 756 GJ24437-PA 135..731 81..652 729 30.1 Plus
Dvir\GJ17765-PA 1397 GJ17765-PA 698..1286 81..651 721 32.5 Plus
Dvir\GJ11112-PA 722 GJ11112-PA 147..721 103..650 669 32.8 Plus
Dvir\GJ17765-PA 1397 GJ17765-PA 67..570 104..658 424 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13846-PA 681 GK13846-PA 5..681 1..658 2561 69.6 Plus
Dwil\GK13447-PA 698 GK13447-PA 72..685 72..654 1274 43.2 Plus
Dwil\GK11651-PA 753 GK11651-PA 132..727 81..651 742 31.2 Plus
Dwil\GK22657-PA 804 GK22657-PA 175..803 50..650 715 32.8 Plus
Dwil\GK24383-PA 1458 GK24383-PA 705..1285 88..651 700 31.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26114-PA 648 GE26114-PA 1..648 10..658 3218 95.5 Plus
Dyak\GE24600-PA 690 GE24600-PA 83..678 76..654 1254 43.3 Plus
Dyak\GE25475-PA 753 GE25475-PA 132..728 81..652 740 30.9 Plus
Dyak\GE25495-PA 809 GE25495-PA 226..808 91..650 705 33.2 Plus
Dyak\GE13192-PA 1394 GE13192-PA 706..1283 88..651 704 32.1 Plus

IP19154.hyp Sequence

Translation from 0 to 1976

> IP19154.hyp
IVLCGVVGAMRVFLVVLSVLSVAVATKCPYSAMEPSLSRSKRSSFDIRPG
VSDGSLDALIKEFMPKYNGNNVHNSWAEPSASQQPLRCGVPPRNCLNDTR
NLHYRTLDGSCNNLLYPEFGIAVSRYRRLLPPRQVEQAPNARLISLSLYG
EQTRNDRFRTMAAMQWGQFVAHDISQLSTQGAPQDCCAEPRHPRCLPINL
PRGGPIAYHTGKTCLHFARSVSDADAICPKVEEPQPEKLTVATAYLDLSS
IYGNNPSQNRKVRLFKGGLLKTSYTNGQHWLPVSQNENGECGAKSECYIV
PDIRNRFSPTIALLQTLLVREHNRLAENLALINPDHSDERIFQEARKINI
AQFQKITYYDWLPLFVGRTYTYLNGLIYPVEPTEYVNDYDETVNPAAYAE
FSAAAFRYAHTQIPGWFSLVAPNRRSNRTMRLSDFLDRTETIRLLDTSDN
FDALLRGLATQLHKRSDGNIDREIKHYFNRKEFEEYGSDLKSIDIQRARD
FGLASYNDVREFCGLRRAVDWADFAHEIPGEKISLLRRLYATPDDVELGV
GGTLEYHVPDALFGPTLLCVIGKQFLNTRRGDRFFFERENEGGFSRAQLA
EIRKVSLSSLFCSNANYLHLIQPNVFVFPNSHNLLLNCNFIPQIDLSKWQ
DLRPQLVH*

IP19154.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-PC 649 CG4009-PC 1..649 10..658 3446 100 Plus
CG4009-PB 649 CG4009-PB 1..649 10..658 3446 100 Plus
Pxd-PC 688 CG3477-PC 91..673 88..651 1212 43.1 Plus
Pxd-PB 690 CG3477-PB 93..675 88..651 1212 43.1 Plus
Pxd-PA 690 CG3477-PA 93..675 88..651 1212 43.1 Plus