Clone IP19619 Report

Search the DGRC for IP19619

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:196
Well:19
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13114-RB
Protein status:IP19619.pep: gold
Sequenced Size:1550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13114 2008-04-29 Release 5.5 accounting
CG13114 2008-04-29 Picked prior to 5.5
CG13114 2008-05-05 Release 5.5 slip selected
CG13114 2008-08-15 Release 5.9 accounting
CG13114 2008-12-18 5.12 accounting

Clone Sequence Records

IP19619.complete Sequence

1550 bp assembled on 2007-11-15

GenBank Submission: BT031225

> IP19619.complete
AAAAGAGTTTCGCACGCGACCGACCAACAGCCAACAAGTGCCATCCATCG
GCGATCCGGGACAGAAATTCCAGCAATTGTGGGGAAAGTGATCGAGCGAG
CGAGGGAGAAATTCAGTTGAAAGATGTTCGAACGCTGCAATTTATTATTT
ATGACCATGCTGATGGCATCGGCACTATTGACCCAAGCCCATTTCCCGGA
ATATTGTGCGGAATGTGAACAGGAGGTGTGGGAACAGGTGCCGTGCAGCG
AGGTGCCCACAACGGTAGCGCCAACAACAACCGGAGGCTCTACGTTGAGC
CCGCCCACAACCAGCGCCACCAGCCCGGGACCTATTTACCCAACAACAAC
CAGTGCCCCACCCACGCCCACGGATTACACTACACAGCCATCGGAGTACA
AGAAGTGCTACTGCGAATGCAAGCTGGGCTGCAAGGAGTTCTGCCGCAAG
GTGATCTCTTCTGAGCCCAAGCAGCCGCTCACCCAGATCTCATCCATTGG
GGAGTATGCCCCAGGTGGCCAGGTGGAGTACACGCATGTCCATCAGCGCA
AATACTTTCCCAAGTACGGAGGCGAATCCTATGGGGGATTGGTAGGACCA
GTGGGCGGACCCAAGGCCTATAAGCCATATCCATTGGTCTACGAACAGGC
GGCATCAGCTGCTTCACCGGCTTCCATTCCCTCGGTGGCTTCCTCACCAG
CGGTGGCCAGCATAGCTGCTCCTAATTACACGCTGGAGGAGTTGGCCCAA
TTGCTTAGCACTGCGTATGGCACCAAGAAGGGCTACCCAGCTAGTGTGCC
AACTCCGCCACGTATTCAGCTTCAGCCAGCTCCCTCCGTTTTCTATTCCC
CGGTTCCAAGCTACAAAAAGCAAGTGGTTCCACTCGTGAGCAAAGTGGCG
CCGGCACCCAAAATCTCCTCCAGCATTAAGTATGCCGCCTCAGCGGTTTC
ATCATCATCATCGGGCGTGTCGGTGGCCAAGATAAAGACTCCCTACGAGG
AGAAGATTGTGGTGGCCACACCGTCTCCCATTTATGAGAGATCCACATCG
TATCCTATTGTTGAAGCACCCAAGGAATACTCGGCGCCCCAGACGGAAGT
CTATCCCGTTGTGCAGAGCCAAACGGAGTCGTATCCCAGCCACACACCCA
TATATCCAAGTCCCACGGAATCCTATCCCAGCCAAAAGGACTCCTACCCC
AGCATCACAGAGTCATATCCCAGCCAAACTGAGTCCTATCAACCGCGTAC
GGAAGCCTATCCCGTACCCCAACCGGAGATCAAGCCATATGGTGGTCCCG
ATTCTGGACCCGATAAGCCATCGTCCACGTTCGATCTGGCCATCGATAAT
TATCTGAAGGACTTCGGATATGGCAACCAAGGAAGGGGATATGCGGACTA
CTAAAGTTCCATACGTTGTTTTTTAGGATTAGTCTAGGCTAGAATGTTTT
CTAGGTATCCCATTATTTATTGATGTACTCCCCGTTTCCTGTTGACTACA
TGATGATTAAATAAATTATTAACGAAAAAAAAAAAAAAAAAAAAAAAAAA

IP19619.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-RB 1590 CG13114-RB 58..1585 2..1529 7625 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9544853..9546254 122..1523 6860 99.3 Plus
chr2L 23010047 chr2L 9544649..9544770 2..123 610 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-RB 1281 CG13114-PB 1..1281 124..1404 6405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-RB 1530 CG13114-RB 1..1522 2..1523 7610 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-PB 426 CG13114-PB 1..426 124..1401 1707 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9546015..9547422 122..1529 7025 99.9 Plus
2L 23513712 2L 9545811..9545932 2..123 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9546015..9547422 122..1529 7025 99.9 Plus
2L 23513712 2L 9545811..9545932 2..123 610 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:50:05 has no hits.

IP19619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:39:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9544855..9546254 124..1524 99   Plus
chr2L 9544648..9544770 1..123 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:15:30 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:56 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:33 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:23 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1522 2..1524 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:56 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1522 2..1524 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:33 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1281 124..1404 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
CG13114-RB 1..1522 2..1524 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9546017..9547416 124..1524 99   Plus
2L 9545810..9545932 1..123 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:56 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9546017..9547416 124..1524 99   Plus
arm_2L 9545810..9545932 1..123 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:11 Download gff for IP19619.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9546017..9547416 124..1524 99   Plus
2L 9545810..9545932 1..123 99 -> Plus

IP19619.pep Sequence

Translation from 123 to 1403

> IP19619.pep
MFERCNLLFMTMLMASALLTQAHFPEYCAECEQEVWEQVPCSEVPTTVAP
TTTGGSTLSPPTTSATSPGPIYPTTTSAPPTPTDYTTQPSEYKKCYCECK
LGCKEFCRKVISSEPKQPLTQISSIGEYAPGGQVEYTHVHQRKYFPKYGG
ESYGGLVGPVGGPKAYKPYPLVYEQAASAASPASIPSVASSPAVASIAAP
NYTLEELAQLLSTAYGTKKGYPASVPTPPRIQLQPAPSVFYSPVPSYKKQ
VVPLVSKVAPAPKISSSIKYAASAVSSSSSGVSVAKIKTPYEEKIVVATP
SPIYERSTSYPIVEAPKEYSAPQTEVYPVVQSQTESYPSHTPIYPSPTES
YPSQKDSYPSITESYPSQTESYQPRTEAYPVPQPEIKPYGGPDSGPDKPS
STFDLAIDNYLKDFGYGNQGRGYADY*

IP19619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22771-PA 465 GF22771-PA 58..465 1..426 1131 65.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10038-PA 422 GG10038-PA 1..422 10..426 1624 85.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10433-PA 377 GH10433-PA 1..377 1..426 750 45.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-PB 426 CG13114-PB 1..426 1..426 2263 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24302-PA 376 GI24302-PA 1..376 1..426 619 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18915-PA 649 GL18915-PA 256..649 1..426 1004 61.4 Plus
Dper\GL19676-PA 112 GL19676-PA 61..112 362..426 171 53.8 Plus
Dper\GL26063-PA 186 GL26063-PA 112..186 348..426 154 48.1 Plus
Dper\GL19221-PA 67 GL19221-PA 37..67 396..426 147 87.1 Plus
Dper\GL13267-PA 94 GL13267-PA 42..91 377..426 142 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12056-PA 450 GA12056-PA 48..450 1..426 1047 61.3 Plus
Dpse\GA25247-PA 88 GA25247-PA 27..88 348..426 226 63.3 Plus
Dpse\GA27914-PA 156 GA27914-PA 41..140 297..420 153 35.5 Plus
Dpse\GA28626-PA 61 GA28626-PA 2..61 349..426 142 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17541-PA 415 GM17541-PA 1..415 10..426 1792 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23614-PA 415 GD23614-PA 1..415 10..426 1636 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21563-PA 391 GJ21563-PA 21..388 20..422 682 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19373-PA 447 GK19373-PA 1..447 1..426 843 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18853-PA 428 GE18853-PA 1..428 1..426 1659 88.1 Plus

IP19619.hyp Sequence

Translation from 123 to 1403

> IP19619.hyp
MFERCNLLFMTMLMASALLTQAHFPEYCAECEQEVWEQVPCSEVPTTVAP
TTTGGSTLSPPTTSATSPGPIYPTTTSAPPTPTDYTTQPSEYKKCYCECK
LGCKEFCRKVISSEPKQPLTQISSIGEYAPGGQVEYTHVHQRKYFPKYGG
ESYGGLVGPVGGPKAYKPYPLVYEQAASAASPASIPSVASSPAVASIAAP
NYTLEELAQLLSTAYGTKKGYPASVPTPPRIQLQPAPSVFYSPVPSYKKQ
VVPLVSKVAPAPKISSSIKYAASAVSSSSSGVSVAKIKTPYEEKIVVATP
SPIYERSTSYPIVEAPKEYSAPQTEVYPVVQSQTESYPSHTPIYPSPTES
YPSQKDSYPSITESYPSQTESYQPRTEAYPVPQPEIKPYGGPDSGPDKPS
STFDLAIDNYLKDFGYGNQGRGYADY*

IP19619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13114-PB 426 CG13114-PB 1..426 1..426 2263 100 Plus