Clone IP19827 Report

Search the DGRC for IP19827

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:27
Vector:pOT2
Associated Gene/TranscriptCG14185-RA
Protein status:IP19827.pep: gold
Sequenced Size:1414

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14185 2008-04-29 Release 5.5 accounting
CG14185 2008-05-05 Release 5.5 slip selected
CG14185 2008-08-15 Release 5.9 accounting
CG14185 2008-12-18 5.12 accounting

Clone Sequence Records

IP19827.complete Sequence

1414 bp assembled on 2008-05-14

GenBank Submission: BT030905

> IP19827.complete
TAGGTGTTGCACTAAGAAATATTAATAATGCCACTGCTGGAGGCACCTGC
GGACTACCTGGAGTCCTCTCCGGATCAATCGCTTCAGGCGGAACTGCCCA
TCCTTCTGGCACCGCCAGGACCGGCCGCCTTGGCCCAGGTCCGGATGCCT
CCGCCCGAGGTGCGGCTCAATCAGCAGAATCCCGCACAGCAGCAGCAGCA
GCGGATGCAGTTCAACCGCCGCCAACTGGGTCGCCGGAACTCCTTCGATC
GGGATGTGGCCATTGCCGAGGAGGAACAGCACCTTCCGGCCTTCGTCCAC
CTGCTGCCCGTGGTGCTACCCCAACAGGGCCCGGAACCGACACTGGACGA
GCTACTGCGCCGAGTGACGCAACGCACGGATCTGGAGGCGGTGGAGCAAG
TGCGTCTGCGCGTGATCTCTTACACAGTCAGCCTGTCCCGCCTGTCGCTC
TTCCTGCCGCGCCTCCAATCCCTCGACCTGAGTGGCAGTGTGCTGAGCTC
CCTGCGCGACCTGGGCTATGGACTCCTCCAGCTAACCCGGTTGGACATCA
GCAACTGCGGCCTGAATAGCTTCGACGGCACCAGTGGACTGCCGGCCATC
CGTGTGCTCATCGCCGATGGAAACATGATCCAGCGGGTTGATCCGCTGGC
CGAACTGGTCCACCTGCGCGTTCTCAAGGCAAGGAACAACCGGATCAGTG
AGCTGGGCCTGCTCTCCTTCTTGGGAATGTGCCCGCAGCTGCAGGAGGTG
GAGTTGCAGGGCAATCCCGTGTGTCGTTTACCGCTCTACCGCTCGCTCCT
GGCGCGCAGTGTGCCCACGTTGCAACTGTTGGATGGACGGGTGTTGAACG
GTGAACCTGCTCCGGTGGAGATGGAGGAGGCCACATCCCCGGCATCAAGT
GATCTGGAGTCTGGCTCCGAGACGACTGCACAACGGCCGAACACGGCGCC
TGCTCCGGAACCCGTTCCTATCGCCTTGAATGCTGCCATCCGGCGCCAAG
TGTCGGCCAGCTCTGGCTCCACTCCAGTGGCCGGATCGGTTTTGAGCCTG
GTGCGCCAGCGGCGAAGGCGCAGTGGCCACGCCTGGGTCAGTTCCTCCTC
CTCCAGCGGATCGTCTTCCGCCTCCTCTGCCCGATCCACGCGGGCGCCAT
CAATGAGCTCCTGCTCCTCCAACAGCAGCCTCGACGTCCAATCATCGTCC
CATTATGTCTTCAGCACACAGTCAACGCTGGACTAGACCACACTGCAAAA
AAGTTAATATTTTATACACAATAATATTATTGACCATATGAATCAGGATT
CTAAATCCTGACTGAACTGGTTATACCAGAAACAAACAAAAAATCAAAAT
TAACAAGCTTGAGAGCTTGTTGAATAAATACACACAATTACTTCATGAAA
AAAAAAAAAAAAAA

IP19827.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-RA 1504 CG14185-RA 108..1504 1..1397 6985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20095789..20096837 357..1397 5045 99 Plus
chr3L 24539361 chr3L 20095366..20095722 1..357 1770 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-RA 1209 CG14185-PA 1..1209 28..1236 6045 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-RA 1397 CG14185-RA 1..1397 1..1397 6985 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-PA 402 CG14185-PA 1..336 28..1035 1312 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20106517..20107558 357..1398 5210 100 Plus
3L 28110227 3L 20106094..20106450 1..357 1785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20099617..20100658 357..1398 5210 100 Plus
3L 28103327 3L 20099194..20099550 1..357 1785 100 Plus
Blast to na_te.dros performed 2014-11-26 19:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 4725..4853 1227..1354 128 60.6 Plus

IP19827.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:18:05 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20095790..20096837 358..1397 98   Plus
chr3L 20095366..20095722 1..357 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:09 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:37 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:53:09 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:53 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:05 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:25 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:37 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1397 1..1397 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:53:09 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1397 1..1397 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:54 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1209 28..1236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:05 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 1..1397 1..1397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:18:05 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20106518..20107557 358..1397 100   Plus
3L 20106094..20106450 1..357 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:53:09 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20099618..20100657 358..1397 100   Plus
arm_3L 20099194..20099550 1..357 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:06 Download gff for IP19827.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20099618..20100657 358..1397 100   Plus
3L 20099194..20099550 1..357 100 -> Plus

IP19827.pep Sequence

Translation from 27 to 1235

> IP19827.pep
MPLLEAPADYLESSPDQSLQAELPILLAPPGPAALAQVRMPPPEVRLNQQ
NPAQQQQQRMQFNRRQLGRRNSFDRDVAIAEEEQHLPAFVHLLPVVLPQQ
GPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLD
LSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNM
IQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR
LPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETT
AQRPNTAPAPEPVPIALNAAIRRQVSASSGSTPVAGSVLSLVRQRRRRSG
HAWVSSSSSSGSSSASSARSTRAPSMSSCSSNSSLDVQSSSHYVFSTQST
LD*

IP19827.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 10:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24585-PA 398 GF24585-PA 1..398 1..402 1376 82.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 10:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16080-PA 401 GG16080-PA 1..401 1..402 1631 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 10:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15104-PA 409 GH15104-PA 1..367 1..354 1116 70.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-PA 402 CG14185-PA 1..402 1..402 1993 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 10:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13755-PA 412 GI13755-PA 1..412 1..402 1089 65.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 10:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25286-PA 404 GL25286-PA 1..404 1..402 1217 72.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 10:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12813-PA 404 GA12813-PA 1..404 1..402 1209 72.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 10:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22255-PA 401 GM22255-PA 1..401 1..402 1764 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 10:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14853-PA 401 GD14853-PA 1..401 1..402 1803 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 10:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13746-PA 403 GJ13746-PA 1..403 1..402 1029 67 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 10:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17136-PA 441 GK17136-PA 1..441 1..402 1182 67 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 10:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23228-PA 400 GE23228-PA 1..400 1..402 1746 93.8 Plus

IP19827.hyp Sequence

Translation from 27 to 1235

> IP19827.hyp
MPLLEAPADYLESSPDQSLQAELPILLAPPGPAALAQVRMPPPEVRLNQQ
NPAQQQQQRMQFNRRQLGRRNSFDRDVAIAEEEQHLPAFVHLLPVVLPQQ
GPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLD
LSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNM
IQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR
LPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETT
AQRPNTAPAPEPVPIALNAAIRRQVSASSGSTPVAGSVLSLVRQRRRRSG
HAWVSSSSSSGSSSASSARSTRAPSMSSCSSNSSLDVQSSSHYVFSTQST
LD*

IP19827.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-PA 402 CG14185-PA 1..402 1..402 1993 100 Plus