Clone IP22154 Report

Search the DGRC for IP22154

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:221
Well:54
Vector:pOT2
Associated Gene/TranscriptCG4950-RB
Protein status:IP22154.pep: gold
Sequenced Size:1804

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4950 2008-05-05 Release 5.5 slip selected

Clone Sequence Records

IP22154.complete Sequence

1804 bp assembled on 2009-10-30

GenBank Submission: BT100183.1

> IP22154.complete
AAAAGATGAATAGAACGCGAAGGATACTCGAAGTGATCGTTATCCTTATT
CTAGCGATATCGAGTTGTGATGGCAGTGGAGGAGATATCCCCCTGCGATG
CGACGAGTACGATTCCATGGGATACATGGACGTGAATGAGGCGTTTTGCA
CGGTCACCGGATTCACGGTCACACACAGTCAAAATGTCGTGATCAAGAAC
ATACCACCCGGAAATATGGTCAAGTTCATGAAGTTTTACGAATCAACGCT
GCTCTATATGCCCTTCCATCTATTCGAAACATTCCCATATCTCAAGACCC
TCGATGTCTCGAATACGAATATTTTGGAGCTAACGAGAAATGCATTCAGT
GCTGCGAGTAATCTCACCTATCTGAATCTGGCCTACAATAATCTGACATC
TATCCAGACTTCTGTGTTTATTGGCGCCAATGTTCTGATGCGTTTGGATT
TGTCCTACAATGAGATATCCTCGCTGAGTGTGAATGCCTTCTGTGGCCTG
CACACCATTAGCCAGATTTATCTAACGGGCAATCTGTTGAAGGAGCTGCA
CAACGATATCTTCAAGGATAACGAGTACTTGGAGAAGGTGTCCTTCGAGG
GAAATCTACTGACCAGCATTCAACCGGAGGTTTTTCGCAATATGCGGCGC
ATCAAGGAGGTTAATCTATCCAATAATCGCCTGATTTTCATCCATCCGGA
CACTTTTGCGGATGCGGCAAGCTTGGAGAATCTGGTGTTGTCCTATAATG
AGTTGAAAAACTTCCAGCTGACGGAGAAGAATATTGTGCATCAGCTGCAC
TTGGATAATAATTATCTTACAAATTTGACCATAAATGCAACTCGATTCGT
TCGCGCCAGTCACAATCAAATTTCGGAGCTCTTTCTGCACCAGAGTTTGC
ATATCGAAACATTGGATTTAAGTGCCAACAAGTTGAGTAGCATATCGAAT
ATCACCAATATCACACATATGCTCTACTTGGATGTATCGGATAATCCAAT
TGGTCCGCTTAATATCAGCACCTTTTCGCAACTTAAGAGACTGAGGGGAC
TAAATTTGCGAGGAACTGGAATTAGAGAGCTTAAATTTGGAATGTTTTCG
AAGCAGAAGTACTTGGAGGAACTGGATCTTTCGTTTAACAACCTGACCAT
TCTCAATTTGGATATGTTTGTGCCCTATCTGACTAATCTGAAGAAGTTCC
TCATCGACGGCAATGGGCTGACTGAGCTGCAGGGAAATCGCACGTTTTCC
GAAGCTTTTCCACAACTTCAGAAATTGGGAGTATCGAGGAACCGCTTCAA
CTGCTCCTATCTACATCATCTACTCATCCCACCATCGCTACCCGAGTCCG
TAGTGCTCAATATTGAACCGGACACCAATCTGGATGAGACCCCACACATT
CGTGACGTATCCTGCATCAGTCAATCCCAGGAGGTCGTTAATGCCTCCTT
CACCGCCGAGGAATCCAAGCTAGAATCGCAGATTCAAATGCTTTCGAAAC
AGTTGGATATTGTAGGCTCGCATTCGAAGAATCTGGAACTTCACCTGGCC
TTTATGCAGATCTTTGCGTACGTTATGGGCGGCCTGGTCCTGGTGGGTGT
GGTGTCACTGATAACCCTTCGATATCTGAAGAATCAACGATCGGGTCGAT
ATGATCGCAGCAGCATTGTCTTCCGCTCCAATGCCACAATGGAAGCTAAT
CTCACCCTGGGCAGTGAAGATCTTCAGTAGCCTGTACATTTTGAACTTTA
TTAAAGTGGAAATAAAATTGCAAAGTTTAAACATTTAAAAAAAAAAAAAA
AAAA

IP22154.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-RB 1740 CG4950-RB 11..1740 1..1730 8650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16256061..16257846 1786..1 8750 99.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-RB 1725 CG4950-PB 1..1725 6..1730 8625 100 Plus
CG4950-RC 1725 CG4950-PC 1..1725 6..1730 8625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:47:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-RB 1796 CG4950-RB 11..1796 1..1786 8915 99.9 Plus
CG4950-RC 2360 CG4950-RC 11..1796 1..1786 8915 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-PB 574 CG4950-PB 1..574 6..1727 2674 100 Plus
CG4950-PC 574 CG4950-PC 1..574 6..1727 2674 100 Plus
alrm-PA 471 CG11910-PA 47..362 156..1169 329 28.9 Plus
CG7509-PA 615 CG7509-PA 183..480 435..1295 252 27.2 Plus
conv-PA 1092 CG8561-PA 385..790 273..1442 252 26.8 Plus
CG7509-PA 615 CG7509-PA 206..503 216..1214 172 22.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16266359..16268146 1788..1 8925 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16259459..16261246 1788..1 8925 99.9 Minus
Blast to na_te.dros performed on 2014-11-27 02:15:02 has no hits.

IP22154.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:51:06 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16256061..16257846 1..1786 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 14:27:45 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RB 1..1725 6..1730 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:48 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RB 1..1725 6..1730 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:12 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RC 1..1725 6..1730 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:51:06 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RC 1..1725 6..1730 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 14:27:44 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RB 11..1740 1..1730 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:48 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RB 11..1740 1..1730 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:12 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RC 11..1796 1..1786 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:51:06 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
CG4950-RC 11..1796 1..1786 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:51:06 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16266361..16268146 1..1786 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:12 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16259461..16261246 1..1786 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:03 Download gff for IP22154.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16259461..16261246 1..1786 99   Minus

IP22154.pep Sequence

Translation from 2 to 1729

> IP22154.pep
KMNRTRRILEVIVILILAISSCDGSGGDIPLRCDEYDSMGYMDVNEAFCT
VTGFTVTHSQNVVIKNIPPGNMVKFMKFYESTLLYMPFHLFETFPYLKTL
DVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQTSVFIGANVLMRLDL
SYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEG
NLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNE
LKNFQLTEKNIVHQLHLDNNYLTNLTINATRFVRASHNQISELFLHQSLH
IETLDLSANKLSSISNITNITHMLYLDVSDNPIGPLNISTFSQLKRLRGL
NLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKKFL
IDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPESV
VLNIEPDTNLDETPHIRDVSCISQSQEVVNASFTAEESKLESQIQMLSKQ
LDIVGSHSKNLELHLAFMQIFAYVMGGLVLVGVVSLITLRYLKNQRSGRY
DRSSIVFRSNATMEANLTLGSEDLQ*

IP22154.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10307-PA 575 GF10307-PA 6..573 6..572 2489 81.7 Plus
Dana\GF18811-PA 1407 GF18811-PA 432..862 55..444 242 25.4 Plus
Dana\GF23159-PA 427 GF23159-PA 69..409 78..452 233 27.4 Plus
Dana\GF24031-PA 740 GF24031-PA 13..398 48..442 227 24.9 Plus
Dana\GF23068-PA 551 GF23068-PA 89..423 78..406 226 28.2 Plus
Dana\GF18811-PA 1407 GF18811-PA 55..537 21..433 214 23.2 Plus
Dana\GF18811-PA 1407 GF18811-PA 387..810 80..440 182 23.2 Plus
Dana\GF23068-PA 551 GF23068-PA 137..398 102..431 167 24.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13481-PA 574 GG13481-PA 1..574 2..575 2791 93.2 Plus
Dere\GG12248-PA 471 GG12248-PA 7..362 8..389 309 28.6 Plus
Dere\GG15893-PA 1514 GG15893-PA 279..626 73..432 249 26.3 Plus
Dere\GG11714-PA 1395 GG11714-PA 430..885 55..467 249 25.1 Plus
Dere\GG15627-PA 738 GG15627-PA 13..398 48..442 238 25.4 Plus
Dere\GG15893-PA 1514 GG15893-PA 327..673 73..381 203 25.4 Plus
Dere\GG11714-PA 1395 GG11714-PA 162..508 97..430 201 25.8 Plus
Dere\GG11714-PA 1395 GG11714-PA 680..1044 85..432 192 26.6 Plus
Dere\GG11714-PA 1395 GG11714-PA 258..586 73..410 174 23.4 Plus
Dere\GG11714-PA 1395 GG11714-PA 596..942 97..404 172 25.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15618-PA 567 GH15618-PA 4..567 6..569 1987 67.4 Plus
Dgri\GH18519-PA 1398 GH18519-PA 424..792 55..379 258 26.9 Plus
Dgri\GH14533-PA 1526 GH14533-PA 282..614 97..432 246 28.4 Plus
Dgri\GH21800-PA 1065 GH21800-PA 388..818 97..502 242 26.4 Plus
Dgri\GH17150-PA 762 GH17150-PA 26..402 59..442 235 25.4 Plus
Dgri\GH18519-PA 1398 GH18519-PA 160..601 23..433 208 24.9 Plus
Dgri\GH18519-PA 1398 GH18519-PA 155..502 120..430 208 27.6 Plus
Dgri\GH18519-PA 1398 GH18519-PA 535..948 90..417 208 24.1 Plus
Dgri\GH18519-PA 1398 GH18519-PA 674..1038 85..432 197 26.7 Plus
Dgri\GH14533-PA 1526 GH14533-PA 295..661 86..381 190 23.4 Plus
Dgri\GH14533-PA 1526 GH14533-PA 425..737 60..407 160 26.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-PB 574 CG4950-PB 1..574 2..575 2913 100 Plus
CG4950-PC 574 CG4950-PC 1..574 2..575 2913 100 Plus
alrm-PA 471 CG11910-PA 47..362 52..389 342 29.4 Plus
conv-PA 1092 CG8561-PA 385..856 91..542 315 25.3 Plus
conv-PB 1092 CG8561-PB 385..856 91..542 315 25.3 Plus
conv-PA 1092 CG8561-PA 191..548 64..409 267 24.4 Plus
conv-PA 1092 CG8561-PA 416..790 52..433 260 26.1 Plus
conv-PA 1092 CG8561-PA 176..519 97..430 259 26.5 Plus
conv-PA 1092 CG8561-PA 604..887 97..406 224 27 Plus
conv-PA 1092 CG8561-PA 125..463 97..425 192 22.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12666-PA 552 GI12666-PA 2..552 7..565 1930 67.7 Plus
Dmoj\GI20549-PA 1054 GI20549-PA 322..815 38..502 261 26.5 Plus
Dmoj\GI22613-PA 582 GI22613-PA 129..509 81..460 248 27 Plus
Dmoj\GI11760-PA 754 GI11760-PA 9..397 47..442 243 25.3 Plus
Dmoj\GI17390-PA 560 GI17390-PA 114..432 92..445 241 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18021-PA 578 GL18021-PA 37..578 28..569 2311 79.5 Plus
Dper\GL12373-PA 543 GL12373-PA 79..417 62..404 271 30.7 Plus
Dper\GL17534-PA 1059 GL17534-PA 393..828 97..502 258 28.3 Plus
Dper\GL14012-PA 1409 GL14012-PA 542..861 90..444 249 24.7 Plus
Dper\GL16459-PA 1194 GL16459-PA 214..578 90..443 224 26.5 Plus
Dper\GL14012-PA 1409 GL14012-PA 681..1045 85..432 203 26.6 Plus
Dper\GL14012-PA 1409 GL14012-PA 162..509 120..430 193 25.9 Plus
Dper\GL14012-PA 1409 GL14012-PA 259..587 73..410 189 24 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18548-PA 578 GA18548-PA 37..578 28..569 2309 79.3 Plus
Dpse\GA10580-PA 544 GA10580-PA 80..418 62..404 272 30.7 Plus
Dpse\GA11276-PA 472 GA11276-PA 47..363 51..389 264 26.5 Plus
Dpse\GA19154-PA 1059 GA19154-PA 393..828 97..502 260 28.3 Plus
Dpse\GA20668-PA 1408 GA20668-PA 542..861 90..444 253 24.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24430-PA 345 GM24430-PA 1..310 2..311 1547 98.7 Plus
Dsec\GM24431-PA 212 GM24431-PA 1..212 364..575 1034 97.2 Plus
Dsec\GM17715-PA 471 GM17715-PA 7..362 8..389 303 28.6 Plus
Dsec\GM25524-PA 1514 GM25524-PA 279..626 73..432 249 26.3 Plus
Dsec\GM12844-PA 1224 GM12844-PA 326..715 93..467 248 25.8 Plus
Dsec\GM25524-PA 1514 GM25524-PA 327..673 73..381 202 25.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12499-PA 574 GD12499-PA 1..574 2..575 2841 97.7 Plus
Dsim\GD18198-PA 471 GD18198-PA 7..362 8..389 311 29.1 Plus
Dsim\GD21488-PA 962 GD21488-PA 430..885 55..467 253 24.9 Plus
Dsim\GD14538-PA 1268 GD14538-PA 279..626 73..432 249 26.3 Plus
Dsim\GD20003-PA 553 GD20003-PA 100..427 78..404 244 30.3 Plus
Dsim\GD14538-PA 1268 GD14538-PA 327..673 73..381 203 25.4 Plus
Dsim\GD21488-PA 962 GD21488-PA 234..544 97..391 198 28.3 Plus
Dsim\GD21488-PA 962 GD21488-PA 53..508 21..430 196 23.7 Plus
Dsim\GD21488-PA 962 GD21488-PA 258..586 73..410 169 23.4 Plus
Dsim\GD21488-PA 962 GD21488-PA 596..942 97..404 163 24.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12644-PA 566 GJ12644-PA 23..566 26..569 2013 69.7 Plus
Dvir\Gp150-PA 1055 GJ22403-PA 396..825 97..502 263 27.4 Plus
Dvir\GJ13467-PA 755 GJ13467-PA 9..397 47..442 241 26 Plus
Dvir\GJ15952-PA 1335 GJ15952-PA 597..945 97..431 236 26.9 Plus
Dvir\GJ23859-PA 571 GJ23859-PA 119..440 81..404 230 27.1 Plus
Dvir\GJ15952-PA 1335 GJ15952-PA 467..866 97..401 167 25.9 Plus
Dvir\GJ15952-PA 1335 GJ15952-PA 763..1081 91..376 166 24.2 Plus
Dvir\GJ15952-PA 1335 GJ15952-PA 665..988 91..425 163 25 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19293-PA 556 GK19293-PA 9..556 14..567 1937 68.8 Plus
Dwil\GK20809-PA 1058 GK20809-PA 397..824 97..502 254 26.9 Plus
Dwil\GK12778-PA 575 GK12778-PA 110..423 78..390 243 30.6 Plus
Dwil\GK13202-PA 1397 GK13202-PA 430..798 55..379 234 26.8 Plus
Dwil\GK18063-PA 1357 GK18063-PA 583..966 71..431 230 25.8 Plus
Dwil\GK13202-PA 1397 GK13202-PA 228..544 91..391 201 26.9 Plus
Dwil\GK13202-PA 1397 GK13202-PA 161..508 120..430 192 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22573-PA 574 GE22573-PA 1..574 2..575 2833 95.3 Plus
Dyak\GE10699-PA 471 GE10699-PA 46..362 51..389 296 28.4 Plus
Dyak\GE22235-PA 1514 GE22235-PA 279..626 73..432 249 26.3 Plus
Dyak\GE23905-PA 1121 GE23905-PA 426..856 55..444 246 25.2 Plus
Dyak\GE21954-PA 740 GE21954-PA 13..398 48..442 240 25.7 Plus
Dyak\GE23905-PA 1121 GE23905-PA 230..582 97..410 208 27.2 Plus
Dyak\GE22235-PA 1514 GE22235-PA 327..673 73..381 204 25.4 Plus
Dyak\GE23905-PA 1121 GE23905-PA 49..504 21..430 201 24 Plus
Dyak\GE23905-PA 1121 GE23905-PA 676..1040 85..432 188 26.4 Plus
Dyak\GE23905-PA 1121 GE23905-PA 537..938 90..404 176 23.6 Plus

IP22154.hyp Sequence

Translation from 2 to 1729

> IP22154.hyp
KMNRTRRILEVIVILILAISSCDGSGGDIPLRCDEYDSMGYMDVNEAFCT
VTGFTVTHSQNVVIKNIPPGNMVKFMKFYESTLLYMPFHLFETFPYLKTL
DVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQTSVFIGANVLMRLDL
SYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEG
NLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNE
LKNFQLTEKNIVHQLHLDNNYLTNLTINATRFVRASHNQISELFLHQSLH
IETLDLSANKLSSISNITNITHMLYLDVSDNPIGPLNISTFSQLKRLRGL
NLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKKFL
IDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPESV
VLNIEPDTNLDETPHIRDVSCISQSQEVVNASFTAEESKLESQIQMLSKQ
LDIVGSHSKNLELHLAFMQIFAYVMGGLVLVGVVSLITLRYLKNQRSGRY
DRSSIVFRSNATMEANLTLGSEDLQ*

IP22154.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4950-PB 574 CG4950-PB 1..574 2..575 2913 100 Plus
CG4950-PC 574 CG4950-PC 1..574 2..575 2913 100 Plus
alrm-PA 471 CG11910-PA 47..362 52..389 342 29.4 Plus
conv-PA 1092 CG8561-PA 385..856 91..542 315 25.3 Plus
conv-PB 1092 CG8561-PB 385..856 91..542 315 25.3 Plus
conv-PA 1092 CG8561-PA 191..548 64..409 267 24.4 Plus
conv-PA 1092 CG8561-PA 416..790 52..433 260 26.1 Plus
conv-PA 1092 CG8561-PA 176..519 97..430 259 26.5 Plus
conv-PA 1092 CG8561-PA 604..887 97..406 224 27 Plus
conv-PA 1092 CG8561-PA 125..463 97..425 192 22.6 Plus