Clone LD02194 Report

Search the DGRC for LD02194

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:21
Well:94
Vector:pBS SK-
Associated Gene/TranscriptRep-RA
Protein status:LD02194.pep: gold
Preliminary Size:1893
Sequenced Size:1884

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8432 2001-01-01 Release 2 assignment
CG8432 2001-10-10 Blastp of sequenced clone
CG8432 2003-01-01 Sim4 clustering to Release 3
Rep 2008-04-29 Release 5.5 accounting
Rep 2008-08-15 Release 5.9 accounting
Rep 2008-12-18 5.12 accounting

Clone Sequence Records

LD02194.complete Sequence

1884 bp (1884 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061052

> LD02194.complete
TAAATTCGCAATAAATTCACGGAATACTTTATTTATCCGTAAATATAGTT
TAAATATCAGTGCAAATAAGGCTTAGAACATGTTGGATGACCTGCCGGAG
CAGTTTGACCTGGTCGTCATAGGCACAGGCTTCACCGAGTCCTGCATCGC
CGCTGCGGGCAGCAGGATAGGCAAATCGGTGCTCCACCTGGATAGTAATG
AGTACTACGGGGATGTTTGGAGCTCCTTCTCTATGGATGCTCTATGTGCC
CGCTTGGACCAGGAAGTCGAGCCTCATTCTGCATTGCGAAACGCAAGGTA
CACCTGGCATTCCATGGAAAAAGAATCAGAAACAGATGCACAATCCTGGA
ATAGGGACTCAGTGCTGGCCAAGTCGCGACGCTTCAGCTTGGATCTATGC
CCGCGCATTTTATACGCAGCCGGGGAGCTGGTGCAGTTGCTCATCAAGTC
GAACATCTGCCGCTATGCTGAATTCCGAGCCGTGGACCATGTGTGCATGC
GCCACAATGGTGAAATTGTGTCCGTGCCCTGCTCCCGTAGCGATGTCTTC
AACACCAAAACACTGACCATCGTGGAAAAGCGCTTGCTGATGAAATTTCT
CACCGCCTGCAACGATTACGGCGAGGACAAGTGCAACGAGGACTCGTTGG
AATTCCGGGGACGAACGTTTCTGGAATATTTGCAGGCGCAGCGGGTGACC
GAAAAGATATCGTCGTGCGTGATGCAGGCCATTGCCATGTGCGGCCCCAG
CACCAGCTTCGAGGAGGGTATGCAGCGCACACAACGATTTCTGGGCAGTC
TGGGCCGCTATGGCAACACACCCTTTCTCTTTCCCATGTATGGCTGCGGG
GAATTGCCGCAGTGCTTCTGCCGTTTGTGCGCTGTTTATGGTGGCATTTA
CTGCCTAAAGCGAGCCGTTGACGACATTGCCTTAGATTCCAATTCGAATG
AGTTCCTGCTGAGCAGCGCAGGGAAAACTTTGCGTGCCAAGAATGTGGTC
TCTGCCCCTGGCTATACACCAGTTTCAAAGGGCATCGAGTTGAAGCCGCA
CATCTCACGTGGCTTGTTCATATCGTCCAGTCCCCTGGGCAATGAGGAGC
TGAACAAGGGAGGTGGTGGTGTAAATCTTCTTCGACTACTTGACAATGAA
GGTGGACGGGAAGCCTTCCTAATACAACTGTCGCACTACACGGGAGCCTG
TCCCGAGGGTTTATATATCTTCCATCTGACCACGCCAGCGTTGAGCGAGG
ATCCAGCGTCTGATCTAGCCATTTTCACTAGCCAACTCTTCGATCAATCA
GACGCACAAATAATATTTAGCTCATACTTCACAATTGCTGCCCAGTCTAG
TAAAAGTCCCGCTGCCGAGCATATTTACTACACCGATCCACCTACCTACG
AGCTGGATTATGACGCGGCCATTGCCAATGCTCGCGACATATTTGGCAAA
ATGTTCCCAGATGCCGACTTTTTGCCACGAGCCCCAGATCCAGAGGAGAT
TGTCGTGGATGGTGAAGACCCTAGTGCCTTGAACGAGCACACTTTGCCCG
AAGATTTGCGGGCACAATTGCACGACATGCAGCAGGCAACTCAGGAAATG
GATATACAAGAGTAGTCATACTAAAATAAAAAGGAGGTTTCCTTGGTCTA
CATATATCATTACTTATTACAAAATTTTCTTAAGTATCTTTCGAATAAGT
TATATATTGTATGCAATTTTTTGATTCATATATTCCTATATATTTATTAT
GTAAATTATTTATAATTGCTAAAAGTACTAGGTATATATAAATGTTTAAA
TGTGAGTGTTTCTGTGCATTTTGCTTTGATAAATATATGTTCGAAAAATA
TGCATTCCAATGCGTAAAAAAAAAAAAAAAAAAA

LD02194.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 2001 Rep-RA 137..2001 1..1865 9325 100 Plus
hpo.b 2458 hpo.b 2321..2458 1872..1735 675 99.2 Minus
hpo.c 2861 hpo.c 2725..2861 1872..1736 670 99.2 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15379512..15380600 126..1214 5430 99.9 Plus
chr2R 21145070 chr2R 15380658..15381308 1215..1865 3210 99.5 Plus
chr2R 21145070 chr2R 15379328..15379456 1..129 630 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1536 CG8432-PA 1..1536 80..1615 7680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1923 CG8432-RA 59..1923 1..1865 9325 100 Plus
hpo-RB 2804 CG11228-RB 2675..2804 1865..1736 650 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-PA 511 CG8432-PA 1..511 80..1612 2549 100 Plus
Gdi-PC 443 CG4422-PC 3..288 98..1021 346 28.8 Plus
Gdi-PB 443 CG4422-PB 3..288 98..1021 346 28.8 Plus
Gdi-PA 443 CG4422-PA 3..288 98..1021 346 28.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19492329..19493417 126..1214 5445 100 Plus
2R 25286936 2R 19493475..19494132 1215..1872 3275 99.8 Plus
2R 25286936 2R 19492145..19492273 1..129 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19493528..19494616 126..1214 5445 100 Plus
2R 25260384 2R 19494674..19495331 1215..1872 3275 99.8 Plus
2R 25260384 2R 19493344..19493472 1..129 645 100 Plus
Blast to na_te.dros performed 2014-11-27 05:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Circe 7450 Circe CIRC 7450bp 6533..6659 1678..1797 149 64.3 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2503..2559 1709..1653 114 66.7 Minus

LD02194.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:47:10 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15380658..15381308 1215..1865 94   Plus
chr2R 15379515..15380600 129..1214 99 -> Plus
chr2R 15379328..15379455 1..128 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:30:25 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 80..1615 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:47:32 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 80..1615 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:46:09 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 80..1615 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:18 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 80..1615 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:10 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 80..1615 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:31:22 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 55..1919 1..1865 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:47:32 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 55..1919 1..1865 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:46:09 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 59..1923 1..1865 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:18 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 55..1919 1..1865 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:10 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 59..1923 1..1865 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:47:10 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19493475..19494125 1215..1865 100   Plus
2R 19492332..19493417 129..1214 100 -> Plus
2R 19492145..19492272 1..128 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:46:09 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15380980..15381630 1215..1865 100   Plus
arm_2R 15379837..15380922 129..1214 100 -> Plus
arm_2R 15379650..15379777 1..128 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:11 Download gff for LD02194.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19494674..19495324 1215..1865 100   Plus
2R 19493531..19494616 129..1214 100 -> Plus
2R 19493344..19493471 1..128 100 -> Plus

LD02194.pep Sequence

Translation from 79 to 1614

> LD02194.pep
MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSF
SMDALCARLDQEVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSR
RFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAVDHVCMRHNGEIVSVP
CSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRGRTFLEY
LQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGRYGNTPFL
FPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKT
LRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNL
LRLLDNEGGREAFLIQLSHYTGACPEGLYIFHLTTPALSEDPASDLAIFT
SQLFDQSDAQIIFSSYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIAN
ARDIFGKMFPDADFLPRAPDPEEIVVDGEDPSALNEHTLPEDLRAQLHDM
QQATQEMDIQE*

LD02194.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11718-PA 517 GF11718-PA 1..517 1..511 2445 85.7 Plus
Dana\GF21994-PA 443 GF21994-PA 1..366 5..396 370 25.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21980-PA 511 GG21980-PA 1..511 1..511 2624 94.5 Plus
Dere\GG24025-PA 443 GG24025-PA 1..366 5..396 374 25.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23002-PA 505 GH23002-PA 1..505 1..511 1883 70.3 Plus
Dgri\GH10775-PA 443 GH10775-PA 1..288 5..314 367 28.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-PA 511 CG8432-PA 1..511 1..511 2678 100 Plus
Gdi-PC 443 CG4422-PC 3..366 7..396 351 26.1 Plus
Gdi-PB 443 CG4422-PB 3..366 7..396 351 26.1 Plus
Gdi-PA 443 CG4422-PA 3..366 7..396 351 26.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18968-PA 517 GI18968-PA 1..517 1..511 1983 71.6 Plus
Dmoj\GI17638-PA 443 GI17638-PA 1..288 5..314 373 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11541-PA 522 GL11541-PA 1..522 1..511 2076 72.4 Plus
Dper\GL25634-PA 443 GL25634-PA 1..366 5..396 371 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21074-PA 522 GA21074-PA 1..522 1..511 2070 72 Plus
Dpse\GA18172-PA 443 GA18172-PA 1..366 5..396 371 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21968-PA 513 GM21968-PA 1..511 1..511 2683 96.9 Plus
Dsec\GM12441-PA 443 GM12441-PA 1..366 5..396 376 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11461-PA 511 GD11461-PA 1..511 1..511 2681 96.7 Plus
Dsim\GD22354-PA 443 GD22354-PA 1..366 5..396 376 25.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20912-PA 508 GJ20912-PA 1..508 1..511 2045 74 Plus
Dvir\GJ18203-PA 443 GJ18203-PA 1..366 5..396 375 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15875-PA 512 GK15875-PA 1..510 1..506 2022 73.4 Plus
Dwil\GK24043-PA 412 GK24043-PA 1..345 1..414 1242 59.7 Plus
Dwil\GK21153-PA 202 GK21153-PA 1..200 308..506 678 66.7 Plus
Dwil\GK24240-PA 443 GK24240-PA 1..288 5..314 374 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12059-PA 511 GE12059-PA 1..511 1..511 2635 94.9 Plus
Dyak\GE10500-PA 443 GE10500-PA 1..366 5..396 371 25.7 Plus

LD02194.hyp Sequence

Translation from 79 to 1614

> LD02194.hyp
MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSF
SMDALCARLDQEVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSR
RFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAVDHVCMRHNGEIVSVP
CSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRGRTFLEY
LQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGRYGNTPFL
FPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKT
LRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNL
LRLLDNEGGREAFLIQLSHYTGACPEGLYIFHLTTPALSEDPASDLAIFT
SQLFDQSDAQIIFSSYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIAN
ARDIFGKMFPDADFLPRAPDPEEIVVDGEDPSALNEHTLPEDLRAQLHDM
QQATQEMDIQE*

LD02194.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-PA 511 CG8432-PA 1..511 1..511 2678 100 Plus
Gdi-PC 443 CG4422-PC 3..366 7..396 351 26.1 Plus
Gdi-PB 443 CG4422-PB 3..366 7..396 351 26.1 Plus
Gdi-PA 443 CG4422-PA 3..366 7..396 351 26.1 Plus