Clone LD02463 Report

Search the DGRC for LD02463

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:24
Well:63
Vector:pBS SK-
Associated Gene/Transcriptwech-RA
Protein status:LD02463.pep: gold
Preliminary Size:2931
Sequenced Size:3269

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1624 2003-07-26 Blastp of sequenced clone
dpld 2008-04-29 Release 5.5 accounting
dpld 2008-08-15 Release 5.9 accounting
wech 2008-12-18 5.12 accounting

Clone Sequence Records

LD02463.complete Sequence

3269 bp (3269 high quality bases) assembled on 2003-07-26

GenBank Submission: BT010087

> LD02463.complete
AAGGTTGGAGTGAAGATTTTGAGCCGAATTCGAATCCTAGTCCCCGCCGC
AATAAGTGGGTCAGAATTGGAGCCGTTCGATTGGGCCAAACAAAAAGCTG
GGCGCCACCGCAGACTGCAGCTAAAACACGCCGCCAAAGTAATTGGAAGA
AGAAGCAGGCGCACAATAGGAATAATTGTTCATGGATTTTTTCGATTTCT
CGTTCGCTTGCAGAAGGAAAAGTGCACGAGGGTGGAACCAAGGGTAAATA
AGATTCGCCCGAAAACGCTTGGAAAATGTAAACAATCTGTAAGCACAGCG
ACGATAAGCGATTTTCAAAGAGTTTGCCAGCTTTTTACATCGATCAAACA
CTCGCATAATAAACGAATAAGAACTGACGATTAAATCGAATTGAAGTGGA
GTGACGACTATGGGATACCCTAGGACCGCGTAGAGTGAATGAATTTGACA
ACGGAAAAGCGCCACTCCATTGACTGCTGCCTTGTGCTATAGAAACGTGA
TCTCACCACTCTTATGATGGAACTTTTGTCAAACAATTCGGTTCCGCAAC
AAATGGCCAGCAGCAATGCGCCGAGCGCCAACAATGTGGCCCACTCCTCA
ACGGCCAACGGAAGTGGAGGCGGCAGTGTGAGCAGCAATGCCAGCAACTC
CTCCGAGCGACTGCTGGCGGGCATCCTGGAGAGCTTTCCCGCCTGGGACC
TCAACGTGGGACTACTGCCCAACGTGGGCCAGAGCTCACCACCACGCGCA
GACTTCTTTATCAATAACTTCCTGGGCGGCCTGGACACGCATGGCGACTT
CAGCATTGGACCCATTGGCAGCGGTGCCCGCAGCAATCCGAAGATGTCGC
CAGAGTCATCTAACAACTCGAGCATCAGCTGCGGTTGGTGCGAGGTTAGT
GCTTCAATACGCTGCCTGGAGTGCAACGAGTTCATGTGCAACGACTGCCT
AAGGGAGCATCGCAACAGTCCGCTGTCCTCCAACCACTCGATCGTGTCCT
TGCCCACGCCCATTGGAGCCTCGCCCACGGGTGGCAGCTCGGTAAATGCA
CAGACTCCGCCCAGCGGCAACTTTATCTGCGACATACACAACGAGATGTT
GCGCTACGTATGTGACTACTGCCGGAAATTGGTGTGTCAGTGCTGCACAC
TGCACGAGCACAAGGAGCACAGCTACGCGTCCATCCAAAGCTTTATGGTG
GGCTCGAAGGAGAAGCTGGAGGGCGCCATTGAGAGCAGCCAGGTGGGCAC
GCGCTGCATTAAGAGCAGCATTGACAAAGCGTTGGCCTTCATCCGGCTTA
TCGAGCGCAATTGCAGCGAGCTGAGCGATAATATACGCAAGGCATTCCGT
CAGTTTATCATTGCCATCGAGGACCGCGAGCGTTTCCTCCTGGACTTTGT
GGAAAAGCTCCGCCAGCGTCGTCTGGCCATCCTACACGATCAGATGGCAG
GCTTAAAGTCTGCTCTCGCCGGACTCTCCGAAACGTCCGATATGCTTAGC
AAGGTGGCGGACAATGCCTGCAACATGGACCAGATTGAAATTGCCATGAA
GTTGACCAATGGGCAGAGGCAGATGGAGCAGTTTGCGGGCATATATAAGG
ACCTGCAGCCAAAACAGGAAGTCTTTGCCTTCGCACCACCAGATTACAGC
CTGCTACAGGATATCCGCAACCAGGGTGGCGTTATCCTGGTGGACGACAA
GAACTTGCCCATCGTCTCTAGCAGCAACGGAATTGTGCCGAGCGTCTCCA
GTGTTAATGCCGTGGCCGCGGCCTCCGTGGGAGTTGTGGGAGGCGTTGCT
GGAGTAGTCGGAGGCGTTGGCGTGTCAAACGGCCTGGACTTGGCCTTCGG
CATGAACATGCCCAACAATCCGCTGAGTGTTGCTTCCTCAAGTGTGCGAC
GTCCCCTGTTGCGAGACAATAGCTTCCGGATTCCATCGCCCATAATGCAA
CCACGCGGAGGAAGTGCCTGTGGGATGTCCAGTGGGATGTCCAGCGCTGC
TCTTGATTGGGAACTCAATGGACTGCGCAGCTCGCCAGGATTACACTTCA
GTGCGCCGCGAACCACGCAGGCCATTCCGGGATGCATGGATCTGGTCAAG
GTGCGTAACTCGAATGCTCTCTCGCTATCCTTCGCCACCGAGGGCCACGA
GGACGGACAGGTGAGCCGGCCATGGGGTCTATGCGTTGATAAAATGGGCC
ACGTTCTCGTATCGGATCGCCGCAACAATCGCGTCCAGGTCTTCAATCCC
GATGGCTCCCTAAAGTTCAAATTCGGCCGTAAAGGCGTGGGCAATGGAGA
GTTCGATCTGCCTGCTGGAATCTGTGTTGACGTTGATAATCGCATTATTG
TGGTCGACAAGGACAATCACCGTGTGCAAATCTTTACCGCCAGCGGCGTC
TTCCTGCTCAAGTTCGGCAGCTACGGCAAGGAGTACGGCCAGTTCCAGTA
TCCGTGGGATGTGGCCGTGAACTCGCGCCGCCAAATTGTGGTTACCGACT
CGCGCAATCATCGCATCCAGCAGTTCGACTCTGAGGGTCGCTTCATCCGC
CAGATAGTGTTCGACAACCATGGGCAAACCAAAGGAATCGCCTCGCCACG
AGGCGTTTGCTACACGCCGACGGGCAACATCATAGTGTCTGACTTTGACA
ACCACTGCCTCTACCTGATTGATCCAGACATCAACGACATTCTTTCCGTG
AAGGGACATGAGGGCTCGGGCTTCCATGAATTTAATCGACCCTCCGGCCT
GTGCTGTGACGACGAGGGCCGCATTATAGTGGCCGATTCAAAGAATCAAC
GCATCCTGGTCTTCAATCAGAACCTGGACTTTATGTGGGATATCGAGGTG
CGACCCTCCATCAATCCCTTGATGCCGCCCACGCTGGACGAGAAAGATCG
CACTTGCGATGTGGCCATAATGCCAGACGGTCGCATTGTGTTCCTCATTG
AACTGTCGCCAGACTCCAAGGAAGGGTCAAACCCTTACAAGCGGTTTGTG
CACGTATTCTAAATAAGGCCACGAGTGCCGATCTTTTTTTTTAGACCATT
TACAAGAGCGAAACCTTAGCGTAGAGTTTCAAATAACATGACGATTATGA
GGAGGTGCCGAAACCGATTTAATAAGAAAAAATCTGAAATCATGAAAGTT
AGCGAAAATTTTTAGCTTAAGTGCTACAACGATTACCTCGATATTGCTTA
AGAGTTATGGTTACGATTTGGTAATTTACAATACAATACGAATTACACAT
AAAAAAAAAAAAAAAAAAA

LD02463.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
wech.l 7672 wech.l 120..3370 1..3251 16255 100 Plus
wech.o 5645 wech.o 120..3370 1..3251 16255 100 Plus
wech-RB 4649 wech-RB 120..3370 1..3251 16255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3371214..3373169 2688..733 9780 100 Minus
chr2R 21145070 chr2R 3376685..3377135 451..1 2255 100 Minus
chr2R 21145070 chr2R 3370508..3370916 3250..2842 2045 100 Minus
chr2R 21145070 chr2R 3373237..3373519 734..452 1415 100 Minus
chr2R 21145070 chr2R 3370999..3371151 2841..2689 765 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
wech-RE 2499 CG42396-PE 1..2499 514..3012 12495 100 Plus
wech-RD 2499 CG42396-PD 1..2499 514..3012 12495 100 Plus
wech-RC 2499 CG42396-PC 1..2499 514..3012 12495 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:48:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
wech-RC 7593 CG42396-RC 41..3290 1..3250 16250 100 Plus
wech-RB 3290 CG42396-RB 41..3290 1..3250 16250 100 Plus
wech-RA 4495 CG42396-RA 179..3215 214..3250 15185 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
wech-PE 832 CG42396-PE 1..830 514..3003 3726 100 Plus
wech-PD 832 CG42396-PD 1..830 514..3003 3726 100 Plus
wech-PC 832 CG42396-PC 1..830 514..3003 3726 100 Plus
wech-PB 832 CG42396-PB 1..830 514..3003 3726 100 Plus
wech-PA 832 CG42396-PA 1..830 514..3003 3726 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7483862..7485817 2688..733 9780 100 Minus
2R 25286936 2R 7489333..7489783 451..1 2255 100 Minus
2R 25286936 2R 7483155..7483564 3251..2842 2050 100 Minus
2R 25286936 2R 7485885..7486167 734..452 1415 100 Minus
2R 25286936 2R 7483647..7483799 2841..2689 765 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7485061..7487016 2688..733 9780 100 Minus
2R 25260384 2R 7490532..7490982 451..1 2255 100 Minus
2R 25260384 2R 7484354..7484763 3251..2842 2050 100 Minus
2R 25260384 2R 7487084..7487366 734..452 1415 100 Minus
2R 25260384 2R 7484846..7484998 2841..2689 765 100 Minus
Blast to na_te.dros performed 2014-11-27 04:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 577..663 1365..1278 122 64.4 Minus

LD02463.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:34:34 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3376685..3377135 1..451 100   Minus
chr2R 3373237..3373519 452..734 100 <- Minus
chr2R 3371214..3373167 735..2688 98 <- Minus
chr2R 3370999..3371151 2689..2841 100 <- Minus
chr2R 3370515..3370916 2842..3243 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:30:59 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 1..2499 514..3012 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:45 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 1..2499 514..3012 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:25 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 1..2499 514..3012 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:34 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 1..2499 514..3012 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:31:41 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RB 56..3305 1..3250 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:44 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RB 56..3305 1..3250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:25 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RB 41..3290 1..3250 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:04:17 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
dpld-RB 56..3305 1..3250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:34 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RB 41..3290 1..3250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:34:34 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7489333..7489783 1..451 100   Minus
2R 7485885..7486167 452..734 100 <- Minus
2R 7483862..7485815 735..2688 100 <- Minus
2R 7483647..7483799 2689..2841 100 <- Minus
2R 7483156..7483564 2842..3250 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:25 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3376838..3377288 1..451 100   Minus
arm_2R 3373390..3373672 452..734 100 <- Minus
arm_2R 3371367..3373320 735..2688 100 <- Minus
arm_2R 3371152..3371304 2689..2841 100 <- Minus
arm_2R 3370661..3371069 2842..3250 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:42:24 Download gff for LD02463.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7490532..7490982 1..451 100   Minus
2R 7487084..7487366 452..734 100 <- Minus
2R 7485061..7487014 735..2688 100 <- Minus
2R 7484846..7484998 2689..2841 100 <- Minus
2R 7484355..7484763 2842..3250 100 <- Minus

LD02463.pep Sequence

Translation from 513 to 3011

> LD02463.pep
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERL
LAGILESFPAWDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGP
IGSGARSNPKMSPESSNNSSISCGWCEVSASIRCLECNEFMCNDCLREHR
NSPLSSNHSIVSLPTPIGASPTGGSSVNAQTPPSGNFICDIHNEMLRYVC
DYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIESSQVGTRCIK
SSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNG
QRQMEQFAGIYKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPI
VSSSNGIVPSVSSVNAVAAASVGVVGGVAGVVGGVGVSNGLDLAFGMNMP
NNPLSVASSSVRRPLLRDNSFRIPSPIMQPRGGSACGMSSGMSSAALDWE
LNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSFATEGHEDGQV
SRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDV
AVNSRRQIVVTDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCY
TPTGNIIVSDFDNHCLYLIDPDINDILSVKGHEGSGFHEFNRPSGLCCDD
EGRIIVADSKNQRILVFNQNLDFMWDIEVRPSINPLMPPTLDEKDRTCDV
AIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF*

LD02463.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13678-PA 832 GF13678-PA 1..832 1..832 4004 94 Plus
Dana\GF11130-PA 1348 GF11130-PA 1080..1308 544..774 406 39.7 Plus
Dana\GF11130-PA 1348 GF11130-PA 1074..1348 499..767 393 34.6 Plus
Dana\GF14706-PA 1046 GF14706-PA 779..1026 540..810 260 28.3 Plus
Dana\GF22313-PA 1188 GF22313-PA 918..1103 583..777 221 31.3 Plus
Dana\GF11130-PA 1348 GF11130-PA 1064..1214 622..774 209 34.4 Plus
Dana\GF22313-PA 1188 GF22313-PA 899..1172 520..811 201 24.1 Plus
Dana\GF14706-PA 1046 GF14706-PA 750..910 605..770 196 30.5 Plus
Dana\GF14625-PA 924 GF14625-PA 465..692 116..333 166 21.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10744-PA 832 GG10744-PA 1..832 1..832 4389 98.9 Plus
Dere\GG21942-PA 1353 GG21942-PA 1085..1313 544..774 412 39.7 Plus
Dere\GG21942-PA 1353 GG21942-PA 1079..1353 499..767 397 35 Plus
Dere\GG21163-PA 1136 GG21163-PA 868..1116 586..810 259 30.5 Plus
Dere\GG18293-PA 1188 GG18293-PA 918..1103 583..777 220 31.3 Plus
Dere\GG21942-PA 1353 GG21942-PA 1069..1219 622..774 209 34.4 Plus
Dere\GG18293-PA 1188 GG18293-PA 899..1172 520..811 204 24.1 Plus
Dere\GG10523-PA 920 GG10523-PA 466..666 121..315 161 22.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20597-PA 834 GH20597-PA 1..834 2..832 3885 88.9 Plus
Dgri\GH22138-PA 1353 GH22138-PA 1039..1313 498..774 413 36.6 Plus
Dgri\GH22138-PA 1353 GH22138-PA 1079..1353 499..767 399 35 Plus
Dgri\GH13439-PA 1101 GH13439-PA 834..1081 540..810 259 28.3 Plus
Dgri\GH24221-PA 1255 GH24221-PA 985..1170 583..777 223 31.3 Plus
Dgri\GH24221-PA 1255 GH24221-PA 966..1202 520..766 201 25.3 Plus
Dgri\GH13439-PA 1101 GH13439-PA 805..965 605..770 194 29.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
wech-PE 832 CG42396-PE 1..832 1..832 4354 100 Plus
wech-PD 832 CG42396-PD 1..832 1..832 4354 100 Plus
wech-PC 832 CG42396-PC 1..832 1..832 4354 100 Plus
wech-PB 832 CG42396-PB 1..832 1..832 4354 100 Plus
wech-PA 832 CG42396-PA 1..832 1..832 4354 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19797-PA 815 GI19797-PA 48..815 48..832 3752 90.8 Plus
Dmoj\GI19367-PA 1340 GI19367-PA 1019..1300 492..774 416 36.7 Plus
Dmoj\GI19367-PA 1340 GI19367-PA 1066..1340 499..767 398 35 Plus
Dmoj\GI13993-PA 1054 GI13993-PA 787..1034 540..810 258 27.9 Plus
Dmoj\GI15721-PA 1181 GI15721-PA 911..1096 583..777 225 31.3 Plus
Dmoj\GI15721-PA 1181 GI15721-PA 892..1165 520..811 204 24.1 Plus
Dmoj\GI13993-PA 1054 GI13993-PA 758..918 605..770 188 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20119-PA 820 GL20119-PA 1..820 14..832 3793 89.3 Plus
Dper\GL11502-PA 1349 GL11502-PA 1081..1309 544..774 412 39.7 Plus
Dper\GL11502-PA 1349 GL11502-PA 1075..1349 499..767 395 35 Plus
Dper\GL21191-PA 1062 GL21191-PA 795..1042 540..810 259 28.3 Plus
Dper\GL14648-PA 1214 GL14648-PA 944..1129 583..777 221 31.3 Plus
Dper\GL11502-PA 1349 GL11502-PA 1065..1215 622..774 209 34.4 Plus
Dper\GL14648-PA 1214 GL14648-PA 925..1198 520..811 201 24.1 Plus
Dper\GL21191-PA 1062 GL21191-PA 766..926 605..770 195 30.5 Plus
Dper\GL19699-PA 289 GL19699-PA 77..259 586..777 188 28.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14054-PB 828 GA14054-PB 1..828 1..832 4017 94.7 Plus
Dpse\GA14054-PA 828 GA14054-PA 1..828 1..832 4017 94.7 Plus
Dpse\GA13495-PA 1349 GA13495-PA 1081..1309 544..774 411 39.7 Plus
Dpse\GA13495-PA 1349 GA13495-PA 1075..1349 499..767 395 35 Plus
Dpse\GA10519-PA 1063 GA10519-PA 796..1043 540..810 260 28.3 Plus
Dpse\GA11485-PA 1218 GA11485-PA 948..1133 583..777 221 31.3 Plus
Dpse\GA13495-PA 1349 GA13495-PA 1065..1215 622..774 209 34.4 Plus
Dpse\GA10519-PA 1063 GA10519-PA 767..927 605..770 195 30.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20790-PA 832 GM20790-PA 1..832 1..832 4397 99.4 Plus
Dsec\GM21930-PA 784 GM21930-PA 516..744 544..774 412 39.7 Plus
Dsec\GM21930-PA 784 GM21930-PA 510..784 499..767 396 35 Plus
Dsec\GM17330-PA 1034 GM17330-PA 766..1014 586..810 259 30.5 Plus
Dsec\GM13725-PA 1204 GM13725-PA 934..1119 583..777 220 31.3 Plus
Dsec\GM21930-PA 784 GM21930-PA 500..650 622..774 209 34.4 Plus
Dsec\GM13725-PA 1204 GM13725-PA 916..1151 520..766 202 25.4 Plus
Dsec\GM16843-PA 921 GM16843-PA 467..667 121..315 160 22.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10251-PA 774 GD10251-PA 1..774 1..832 3716 90.7 Plus
Dsim\GD15308-PA 392 GD15308-PA 1..392 441..832 2085 99 Plus
Dsim\GD24189-PA 378 GD24189-PA 110..358 586..810 247 30.5 Plus
Dsim\GD23513-PA 919 GD23513-PA 465..665 121..315 159 22.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18454-PA 822 GJ18454-PA 1..822 1..832 3847 88.9 Plus
Dvir\GJ19924-PA 1346 GJ19924-PA 1025..1306 492..774 414 36.7 Plus
Dvir\GJ19924-PA 1346 GJ19924-PA 1072..1346 499..767 397 35 Plus
Dvir\GJ18246-PA 1046 GJ18246-PA 779..1026 540..810 261 28.3 Plus
Dvir\GJ15250-PA 1180 GJ15250-PA 910..1095 583..777 224 31.3 Plus
Dvir\GJ15250-PA 1180 GJ15250-PA 891..1127 520..766 202 25.3 Plus
Dvir\GJ18246-PA 1046 GJ18246-PA 750..910 605..770 195 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10704-PA 838 GK10704-PA 1..838 1..832 3737 86.4 Plus
Dwil\GK20936-PA 1354 GK20936-PA 1033..1314 492..774 419 36.7 Plus
Dwil\GK20936-PA 1354 GK20936-PA 1080..1354 499..767 397 35 Plus
Dwil\GK23851-PA 1100 GK23851-PA 833..1080 540..810 261 28.3 Plus
Dwil\GK25092-PA 1311 GK25092-PA 1041..1226 583..777 220 31.3 Plus
Dwil\GK25092-PA 1311 GK25092-PA 1022..1258 520..766 202 25.3 Plus
Dwil\GK23851-PA 1100 GK23851-PA 804..964 605..770 195 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23959-PA 819 GE23959-PA 1..819 14..832 4323 99 Plus
Dyak\GE12016-PA 1354 GE12016-PA 1086..1314 544..774 412 39.7 Plus
Dyak\GE12016-PA 1354 GE12016-PA 1080..1354 499..767 396 35 Plus
Dyak\GE13236-PA 1035 GE13236-PA 767..1015 586..810 259 30.5 Plus
Dyak\GE15827-PA 1186 GE15827-PA 916..1101 583..777 221 31.3 Plus
Dyak\GE12016-PA 1354 GE12016-PA 1070..1220 622..774 209 34.4 Plus
Dyak\GE15827-PA 1186 GE15827-PA 897..1133 520..766 202 25.3 Plus

LD02463.hyp Sequence

Translation from 513 to 3011

> LD02463.hyp
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERL
LAGILESFPAWDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGP
IGSGARSNPKMSPESSNNSSISCGWCEVSASIRCLECNEFMCNDCLREHR
NSPLSSNHSIVSLPTPIGASPTGGSSVNAQTPPSGNFICDIHNEMLRYVC
DYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIESSQVGTRCIK
SSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNG
QRQMEQFAGIYKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPI
VSSSNGIVPSVSSVNAVAAASVGVVGGVAGVVGGVGVSNGLDLAFGMNMP
NNPLSVASSSVRRPLLRDNSFRIPSPIMQPRGGSACGMSSGMSSAALDWE
LNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSFATEGHEDGQV
SRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDV
AVNSRRQIVVTDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCY
TPTGNIIVSDFDNHCLYLIDPDINDILSVKGHEGSGFHEFNRPSGLCCDD
EGRIIVADSKNQRILVFNQNLDFMWDIEVRPSINPLMPPTLDEKDRTCDV
AIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF*

LD02463.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
wech-PE 832 CG42396-PE 1..832 1..832 4354 100 Plus
wech-PD 832 CG42396-PD 1..832 1..832 4354 100 Plus
wech-PC 832 CG42396-PC 1..832 1..832 4354 100 Plus
wech-PB 832 CG42396-PB 1..832 1..832 4354 100 Plus
wech-PA 832 CG42396-PA 1..832 1..832 4354 100 Plus