Clone LD02884 Report

Search the DGRC for LD02884

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:28
Well:84
Vector:pBS SK-
Associated Gene/TranscriptDyrk2-RA
Protein status:LD02884.pep: gold
Preliminary Size:3951
Sequenced Size:4058

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4551 2003-01-01 Sim4 clustering to Release 3
CG4551 2003-04-25 Blastp of sequenced clone
smi35A 2008-04-29 Release 5.5 accounting
smi35A 2008-08-15 Release 5.9 accounting
smi35A 2008-12-18 5.12 accounting

Clone Sequence Records

LD02884.complete Sequence

4058 bp (4058 high quality bases) assembled on 2003-04-25

GenBank Submission: BT010088

> LD02884.complete
ATCGCGCTTGTGCGGTTGTGCGGAGCGGACGAGTTGGAATAACCAGCGAG
GTTCAATATTTTCTGTACGGGCGCATTGTTTGAGGCTCGTTTGGAGAACT
GCAGGCGTTCAAAACACGGAATCGAAATCGAATAACATAGCCCCCTCCAC
AAAACCAAATCAATCCAAATTCAAATCGTTCGCGAGTCGAAAGTGAAATT
CGTCGCAGCACAACGGTAAATCAAAGCCAGACGCGATTTTTGTTCAATGA
ATGGAATAGAGCCAGCTAACACAAATCCCGCTAAAATAATCAAATTCAAT
TACAATTTATTGTAACCGCTTTAATAATTAGCATTGCAAAGTGTCTATGC
TAAAGTGTTTAACAGTTTAACAAATAACACAAATATCGGTGATTTTGGTG
TGCAAGAAATTGAGAAAACCAGAAACCAAAACAGAGATCCGCTGATTTAA
GACGAAAGAAGAAATCTTTATGTTTTGCGTGAACATATAGTGAGAAACTA
ATCAACAAGAATTTAAGTAATCTTAGACGTCTTGATTGCGCAAGAGTAAA
CCTTTTTGTTTTGGACAAGTTGGCACCCAACAAGCAAAACAAATGCAAAT
GTGCGCCCCAAAGACATATTACCCCGAAAGTGATCAATAATTGTTTGCCG
GAAGAGGAGATACAACTCAACCAGTTAAGCACCGGACTCAGGGTGACTAC
TCTTCGTGGACACGATTCTCTTTTGGCTAAAACGACAACTCAGCGAAGTC
GACACAATGTTGGATCGATGCGAAATGCCGATCCAGCTGGACAACGAGAA
GTTGCGGCGGGATGTTCGATTGTCGGGCTCTCGACTTGATTTGCCACAAC
TCTGTAATGGATCCCGTCGGTTGGATGGCCACAACAACCATGTGGCTGCC
AATGAGAACACGGTTACAACGACATCCCTGAATGGAAATGGCAACGGCAA
TGGCAATAGCAATAGCAACAACAACAACAACATCGGATCGCCCGTCTCCT
CATCGACAACAAACAGCAGTAATGGCGGCAACGAGCGCGGCTCCTCCACA
AAGTCCAATAGCAGCAGTGGAAGTGGCAGCTCGGGAAACTCGGCCAGCAG
CACGGGAAGTGGCGAGCTCAAATGCAATACGCCCATGACGCCATCTGAGC
TGGTGAAGAAGTTCCGCAACTACCTAACCGATCTTGAGTTCGAAGAGCTC
AAGGTGTACAAGGAAGTGTGGTATTTTGGCCAGCACGCCAGCAAGAACTA
CAACAAACCCGCCCCCACAGCCAATACCACAAATCTGGGCTATGACGATG
ATAATGGCAACTACAAGATCATCGAACACGATCACATAGCTTTTCGTTAC
GAGATTCTGGAGGTAATTGGCAAGGGCAGTTTTGGCCAGGTCATCAGGGC
GCTGGATCACAAGACCAACACACACGTGGCCATCAAGATCATAAGGAACA
AGAAGCGCTTCCTCAACCAGGCCGTCGTCGAACTGAATATCCTCGATGAG
CTGCGCGAAAAGGACGCGGATGGATCTCATAATGTCATACACATGCTCGA
CTATACATATTTCCGCAAGCATTTGTGTATTACTTTTGAGCTAATGAGCT
TGAACCTGTACGAATTGATAAAGAAGAACAACTACAATGGATTCAGCATG
AGTCTCATACGACGCTTCTGCAACTCGATTGTGAAGTGCCTGCGTTTGCT
CTATAAGGAAAACATTATTCACTGTGATCTCAAGCCGGAAAATATCTTGC
TCAAACAGCGTGGTAGCAGCTCCATTAAAGTTATCGACTTTGGCAGCTCA
TGCTACGTGGATCGCAAAATCTATACGTACATCCAATCGAGGTTCTATCG
CTCCCCGGAGGTGATTCTCGGCCTGCAATACGGCACAGCCATCGATATGT
GGAGCTTGGGCTGCATTCTGGCCGAGCTGTACACAGGATTCCCGCTCTTC
CCTGGCGAAAATGAAGTGGAGCAGTTAGCCTGCATCATGGAGGTGCTCGG
TTTGCCGCCTAAGGTGCTCATATCGGTTGCCAGGCGACGTCGGCTGTTCT
TTGATTCCCGTGATGCCCCGCGCTGCATAACTAACACCAAGGGACGCAAA
CGGTCGCCAGGCAGCAAGTCGCTGGCACATATCTTGCACTGCCAGGACCG
CTATTTCATCGACTTCCTGCAGCGTTGCTTGGAGTGGGATCCTGCGGAGC
GGATGACGCCGGACGAGGCGGCCCACCACGAGTTTCTGCAGCCATCTGCC
TCCAGTCGCCATCGCAGCTGCCGCATGTCGAGCAGTTCGTCCAGTTCCGG
ACTCAACAGTGTTTCCCAGAAGTCTTCCTGCTACAGCTTTTCGGAGATCT
CGCCGGGCACCAACGGTCCCGTGGTGGCCTCGATCACCAGCACCACGGCG
GTGCACAATGCCGCGATTGCTACCACAACCAAGTCGAGACAGCAGCCGCC
ATCTCAGAGTCACGGCCATGCCCAATCGAATGGACACCTGCCCGACATCA
AGTTAAGTGCCAGCGATAAGTACAATAGCATGCAGAAGGTGGCGGTGCGC
TCGAAGATCACGTCCAGCGTCTCGGATCTGGAGTCCGTGCAGCAGTACTC
ACTGCACCGCATCTACGGAGGAGTGGGTAGTGGCAGCACACACCATGTCT
CGTCAGCGGCCACCAGGAAACATTTGCCCGGTACAGGCAGTGGAATTGTG
GGTGCCATGTCTTCCAAATACGGCAGCTCAACGTTGGCGCACAACCATCA
CAATGTGACGCACCACAATGCATCGACTGCCACCATTGCAACGACCACGC
ACCACCATCACCACCATGGTGGGCAGCAGCAACAGCAGTCGTCGTCGGGA
GCATCCACCATGGCCATGTCGCACTCACAGTCCACTGGAGATGTTTCCGA
CAGGGCCATCTTTGGGAGAGCTTGACTTCGGGCAAGGCCCACCAAGCTGG
AGCTGAAGAAGTGCAAGCTGGTCAACATGATGGACTTCTGGAGCTAGAAG
TGGCGTCCACAGCACTGCGCTGATGTTAAGGAGCGGGACGAGGAGTAGCC
GATGGAATAGGGCTCCTCGCACGTAGATTTAGGTATATTGTTGTATGTAA
GCTATATAGGAATTCTAGACGTGTGTGAATTGTATTTGAATGCGAGTGCA
TGCTGTTGTACAACCACTTGCTCCTGATAATCCCTTCCCCACTCGAAATA
GTTGCATCTAGCTAGAAGGGAGTACCTTTTTGAAGCACTTTGCAGTATTC
TCAGTTGCCCTGAACCCTATTTTATTTCGCTACTGCCATAGCTAAAGGTA
TTCAAAATCGTATTCACACCCACAAACCCTTCCTGAAAAGTATTCTCTTC
CCTCCAACTCCCTCCATCCTTTTACACTGTATTCAAAATGAACAAACCAT
CAAAGATAAAAACAAAAGAAACGAAACAGAAGCCAGCTCAAAGGAACAAG
ATAACCTAGATATAGTTTATTAGATATGGCATATACTAAACATAGTTGTA
GACAACATTTGTAACGATTCACCCAACGCATCCAATCACCCGAACTCAAA
GATACATACATATTTTAGGGGTTACGACTCAAATCTGTAACAATTTCATA
CAGCTTCCATGTCTTTTGCAACAGTATCAAGGCTGTTATTAGTTACATAT
GCGAAACAGAAATGTATCTATATCTTAACTGTAATTGTATGCGTAGTTTA
AGATCTTGGAGGTTCGTTGGCCAATATCATACATCACACTACAGGAAATC
AACTCTGTAGCCTGCCAATGCAAGATAAATTTGAATTCCGCTTGGATACA
TATACTTGATCCCATTAAACCAATCCATACGGAATACATGTCATAATTTA
ATGAAAACACATATTTAAAAACTATAAATCTATTAAAACTAGACGGATTG
AAAAAAAAATATGGCCAATATCACAACCGAATAATAAACAATCCAATATA
CAATAATTGTAGTGCGCCACATCTAAGTAAACTGTATTAGTGGCGACAAA
AGCAAAAGAAAACAAATAAAAATGTTTTATCCAATTTAAAAAAAAAAAAA
AAAAAAAA

LD02884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
smi35A-RE 4636 smi35A-RE 512..4091 461..4040 17885 99.9 Plus
smi35A-RC 4910 smi35A-RC 786..4365 461..4040 17885 99.9 Plus
smi35A.b 4863 smi35A.b 739..4318 461..4040 17885 99.9 Plus
smi35A-RE 4636 smi35A-RE 47..507 1..461 2305 100 Plus
smi35A-RC 4910 smi35A-RC 248..708 1..461 2305 100 Plus
smi35A.b 4863 smi35A.b 274..734 1..461 2305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14183799..14185924 4034..1909 10600 99.9 Minus
chr2L 23010047 chr2L 14232445..14232905 461..1 2305 100 Minus
chr2L 23010047 chr2L 14195701..14196073 1147..775 1850 99.7 Minus
chr2L 23010047 chr2L 14194506..14194783 1598..1321 1390 100 Minus
chr2L 23010047 chr2L 14196431..14196643 780..568 1065 100 Minus
chr2L 23010047 chr2L 14187633..14187806 1910..1737 870 100 Minus
chr2L 23010047 chr2L 14194848..14195021 1320..1147 870 100 Minus
chr2L 23010047 chr2L 14187864..14188005 1738..1597 710 100 Minus
chr2L 23010047 chr2L 14220797..14220863 526..460 335 100 Minus
chr2L 23010047 chr2L 14215807..14215851 569..525 225 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-RF 2241 CG4551-PF 1..2241 757..2997 11205 100 Plus
Dyrk2-RE 2169 CG4551-PE 1..2169 757..2925 10845 100 Plus
Dyrk2-RD 2169 CG4551-PD 1..2169 757..2925 10845 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-RA 4037 CG4551-RA 1..4034 1..4034 20170 100 Plus
Dyrk2-RE 4590 CG4551-RE 1..4039 1..4034 20085 99.9 Plus
Dyrk2-RF 4663 CG4551-RF 539..4112 461..4034 17870 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-PF 746 CG4551-PF 1..746 757..2994 2949 99.9 Plus
Dyrk2-PE 722 CG4551-PE 1..722 757..2922 2830 100 Plus
Dyrk2-PD 722 CG4551-PD 1..722 757..2922 2830 100 Plus
Dyrk2-PA 722 CG4551-PA 1..722 757..2922 2830 100 Plus
Dyrk2-PB 722 CG4551-PB 1..722 757..2922 2830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14185023..14187154 4040..1909 10645 100 Minus
2L 23513712 2L 14233648..14234108 461..1 2305 100 Minus
2L 23513712 2L 14196927..14197299 1147..775 1850 99.7 Minus
2L 23513712 2L 14195733..14196010 1598..1321 1390 100 Minus
2L 23513712 2L 14197657..14197869 780..568 1065 100 Minus
2L 23513712 2L 14188863..14189036 1910..1737 870 100 Minus
2L 23513712 2L 14196075..14196248 1320..1147 870 100 Minus
2L 23513712 2L 14189094..14189235 1738..1597 710 100 Minus
2L 23513712 2L 14222017..14222083 526..460 335 100 Minus
2L 23513712 2L 14217027..14217071 569..525 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14185023..14187154 4040..1909 10645 99.9 Minus
2L 23513712 2L 14233648..14234108 461..1 2305 100 Minus
2L 23513712 2L 14196927..14197299 1147..775 1850 99.7 Minus
2L 23513712 2L 14195733..14196010 1598..1321 1390 100 Minus
2L 23513712 2L 14197657..14197869 780..568 1065 100 Minus
2L 23513712 2L 14196075..14196248 1320..1147 870 100 Minus
2L 23513712 2L 14188863..14189036 1910..1737 870 100 Minus
2L 23513712 2L 14189094..14189235 1738..1597 710 100 Minus
2L 23513712 2L 14222017..14222083 526..460 335 100 Minus
2L 23513712 2L 14217027..14217071 569..525 225 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:40:53 has no hits.

LD02884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:01:19 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14232445..14232905 1..461 100   Minus
chr2L 14220797..14220861 462..526 100 <- Minus
chr2L 14215807..14215849 527..569 100 <- Minus
chr2L 14196431..14196641 570..780 100 <- Minus
chr2L 14195701..14196067 781..1147 88 <- Minus
chr2L 14194848..14195020 1148..1320 100 <- Minus
chr2L 14194506..14194783 1321..1598 100 <- Minus
chr2L 14187865..14188003 1599..1737 100 <- Minus
chr2L 14187634..14187805 1738..1909 100 <- Minus
chr2L 14183796..14185923 1910..4037 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:46:16 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RA 1..2169 757..2925 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:01 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RA 1..2169 757..2925 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:49 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RF 1..2241 757..2997 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:26 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RA 1..2169 757..2925 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:19 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
Dyrk2-RF 1..2241 757..2997 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:46:16 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RE 1..4042 1..4037 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:01 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RE 1..4042 1..4037 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:49 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RA 1..4037 1..4037 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:26 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RE 1..4042 1..4037 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:19 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
Dyrk2-RA 1..4037 1..4037 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:01:19 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14233648..14234108 1..461 100   Minus
2L 14222017..14222081 462..526 100 <- Minus
2L 14217027..14217069 527..569 100 <- Minus
2L 14197657..14197867 570..780 100 <- Minus
2L 14196927..14197293 781..1147 100 <- Minus
2L 14196075..14196247 1148..1320 100 <- Minus
2L 14195733..14196010 1321..1598 100 <- Minus
2L 14189095..14189233 1599..1737 100 <- Minus
2L 14188864..14189035 1738..1909 100 <- Minus
2L 14185026..14187153 1910..4037 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:49 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14233648..14234108 1..461 100   Minus
arm_2L 14222017..14222081 462..526 100 <- Minus
arm_2L 14217027..14217069 527..569 100 <- Minus
arm_2L 14197657..14197867 570..780 100 <- Minus
arm_2L 14196927..14197293 781..1147 100 <- Minus
arm_2L 14196075..14196247 1148..1320 100 <- Minus
arm_2L 14195733..14196010 1321..1598 100 <- Minus
arm_2L 14189095..14189233 1599..1737 100 <- Minus
arm_2L 14188864..14189035 1738..1909 100 <- Minus
arm_2L 14185026..14187153 1910..4037 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:30 Download gff for LD02884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14233648..14234108 1..461 100   Minus
2L 14222017..14222081 462..526 100 <- Minus
2L 14217027..14217069 527..569 100 <- Minus
2L 14197657..14197867 570..780 100 <- Minus
2L 14196927..14197293 781..1147 100 <- Minus
2L 14196075..14196247 1148..1320 100 <- Minus
2L 14195733..14196010 1321..1598 100 <- Minus
2L 14189095..14189233 1599..1737 100 <- Minus
2L 14188864..14189035 1738..1909 100 <- Minus
2L 14185026..14187153 1910..4037 99 <- Minus

LD02884.pep Sequence

Translation from 756 to 2924

> LD02884.pep
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANE
NTVTTTSLNGNGNGNGNSNSNNNNNIGSPVSSSTTNSSNGGNERGSSTKS
NSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKV
YKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEI
LEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELR
EKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSL
IRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCY
VDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPG
ENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRS
PGSKSLAHILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQPSASS
RHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVASITSTTAVH
NAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSK
ITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGA
MSSKYGSSTLAHNHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGAS
TMAMSHSQSTGDVSDRAIFGRA*

LD02884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 12:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15600-PA 728 GF15600-PA 1..728 1..722 2854 86.4 Plus
Dana\GF20860-PA 1089 GF20860-PA 233..624 140..498 822 45 Plus
Dana\GF24757-PA 1332 GF24757-PA 156..501 183..493 596 34.6 Plus
Dana\GF17020-PA 1260 GF17020-PA 895..1227 180..494 468 29 Plus
Dana\GF10569-PA 935 GF10569-PA 590..932 168..495 415 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 12:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10156-PA 718 GG10156-PA 1..718 1..722 3173 98.2 Plus
Dere\GG16414-PA 837 GG16414-PA 199..596 118..495 1066 51.2 Plus
Dere\GG18154-PA 919 GG18154-PA 144..490 176..498 828 48.1 Plus
Dere\GG14728-PA 1423 GG14728-PA 172..517 183..493 597 34.6 Plus
Dere\GG11626-PA 2969 GG11626-PA 2604..2936 180..494 474 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 12:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10596-PA 729 GH10596-PA 1..729 1..722 2933 87.8 Plus
Dgri\GH23987-PA 892 GH23987-PA 351..730 127..493 1086 52.3 Plus
Dgri\GH12565-PA 846 GH12565-PA 143..499 176..515 825 46.4 Plus
Dgri\GH16233-PA 1480 GH16233-PA 228..573 183..493 596 34.6 Plus
Dgri\GH13234-PA 2060 GH13234-PA 1688..2026 180..494 481 29.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-PF 746 CG4551-PF 1..722 1..722 3779 100 Plus
Dyrk2-PE 722 CG4551-PE 1..722 1..722 3779 100 Plus
Dyrk2-PD 722 CG4551-PD 1..722 1..722 3779 100 Plus
Dyrk2-PA 722 CG4551-PA 1..722 1..722 3779 100 Plus
Dyrk2-PB 722 CG4551-PB 1..722 1..722 3779 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 12:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17385-PA 755 GI17385-PA 1..651 1..640 2729 89 Plus
Dmoj\GI14115-PA 636 GI14115-PA 211..592 127..495 1093 52.6 Plus
Dmoj\GI16344-PA 829 GI16344-PA 150..493 176..495 819 48 Plus
Dmoj\GI16660-PA 1681 GI16660-PA 176..521 183..493 597 34.3 Plus
Dmoj\GI22371-PA 2050 GI22371-PA 1678..2016 180..494 475 28.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 12:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21056-PA 729 GL21056-PA 1..729 1..722 2833 87.8 Plus
Dper\GL18373-PA 632 GL18373-PA 8..391 140..516 1097 53.3 Plus
Dper\GL14559-PA 868 GL14559-PA 135..481 176..498 829 48.1 Plus
Dper\GL24199-PA 381 GL24199-PA 6..348 170..494 438 28.6 Plus
Dper\GL16105-PA 909 GL16105-PA 556..906 160..495 424 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 12:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18250-PA 729 GA18250-PA 1..729 1..722 2921 89.7 Plus
Dpse\GA20611-PA 771 GA20611-PA 147..493 176..498 827 48.1 Plus
Dpse\GA14321-PA 1478 GA14321-PA 156..501 183..493 594 34.6 Plus
Dpse\GA30162-PA 1014 GA30162-PA 643..981 180..494 463 28.8 Plus
Dpse\GA30162-PD 590 GA30162-PD 199..557 151..494 452 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 12:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14885-PA 695 GM14885-PA 1..695 1..722 2962 94.5 Plus
Dsec\GM13004-PA 838 GM13004-PA 200..597 118..495 1061 51.2 Plus
Dsec\GM22846-PA 607 GM22846-PA 142..490 176..500 817 47.9 Plus
Dsec\GM14344-PA 1414 GM14344-PA 196..541 183..493 593 34.6 Plus
Dsec\GM12747-PA 2050 GM12747-PA 1685..2017 180..494 471 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 12:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22014-PA 720 GD22014-PA 1..720 1..722 3183 99.2 Plus
Dsim\GD15658-PA 911 GD15658-PA 142..488 176..498 828 48.1 Plus
Dsim\GD11020-PA 1744 GD11020-PA 167..512 183..493 587 35.2 Plus
Dsim\GD24405-PA 411 GD24405-PA 1..171 342..495 449 53.2 Plus
Dsim\GD21389-PA 570 GD21389-PA 224..537 199..494 448 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 12:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18062-PA 730 GJ18062-PA 1..730 1..722 2912 86.9 Plus
Dvir\GJ14450-PA 1294 GJ14450-PA 672..1053 127..495 1107 52.3 Plus
Dvir\GJ11137-PA 594 GJ11137-PA 308..580 151..427 915 58.5 Plus
Dvir\GJ15681-PA 625 GJ15681-PA 146..489 176..495 786 46.8 Plus
Dvir\GJ12912-PA 1546 GJ12912-PA 182..527 183..493 598 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 12:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15100-PA 724 GK15100-PA 1..724 1..722 2896 89.1 Plus
Dwil\GK13652-PA 662 GK13652-PA 122..606 67..564 1108 46 Plus
Dwil\GK10086-PA 893 GK10086-PA 141..484 176..495 822 48 Plus
Dwil\GK16639-PA 1297 GK16639-PA 82..427 183..493 596 34.6 Plus
Dwil\GK22547-PA 2101 GK22547-PA 1730..2068 180..494 468 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 12:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25082-PA 720 GE25082-PA 1..720 1..722 3172 98.8 Plus
Dyak\GE14483-PA 831 GE14483-PA 194..591 118..495 1068 51.2 Plus
Dyak\GE15563-PA 925 GE15563-PA 99..490 140..498 820 44.2 Plus
Dyak\GE21090-PA 1423 GE21090-PA 169..514 183..493 596 34.6 Plus
Dyak\GE23814-PA 853 GE23814-PA 482..820 180..494 458 27.9 Plus

LD02884.hyp Sequence

Translation from 756 to 2924

> LD02884.hyp
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANE
NTVTTTSLNGNGNGNGNSNSNNNNNIGSPVSSSTTNSSNGGNERGSSTKS
NSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKV
YKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEI
LEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELR
EKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSL
IRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCY
VDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPG
ENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRS
PGSKSLAHILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQPSASS
RHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVASITSTTAVH
NAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSK
ITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGA
MSSKYGSSTLAHNHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGAS
TMAMSHSQSTGDVSDRAIFGRA*

LD02884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-PF 746 CG4551-PF 1..722 1..722 3779 100 Plus
Dyrk2-PE 722 CG4551-PE 1..722 1..722 3779 100 Plus
Dyrk2-PD 722 CG4551-PD 1..722 1..722 3779 100 Plus
Dyrk2-PA 722 CG4551-PA 1..722 1..722 3779 100 Plus
Dyrk2-PB 722 CG4551-PB 1..722 1..722 3779 100 Plus