Clone LD03509 Report

Search the DGRC for LD03509

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:35
Well:9
Vector:pBS SK-
Associated Gene/Transcriptexd-RA
Protein status:LD03509.pep: gold
Preliminary Size:2413
Sequenced Size:2433

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8933 2001-10-10 Blastp of sequenced clone
CG8933 2003-01-01 Sim4 clustering to Release 3
exd 2008-04-29 Release 5.5 accounting
exd 2008-08-15 Release 5.9 accounting
exd 2008-12-18 5.12 accounting

Clone Sequence Records

LD03509.complete Sequence

2433 bp (2433 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061065

> LD03509.complete
AGCATGGACTGCGATATGCGTTCAAAATGTCGATGTTCATGTGTCCTGCA
GTGTATACAGAACGTACTTTCGTTTCATTGTTGTCCAAAAAAGATAATAA
TATTATATACTTGCGGTTATTTACAACTGCAAGTAATGTGTCACTAATTT
TTAGTGAAAATAACACAAAATACGACTTGTACGGCAAATAAGTATACGAG
GCAATCACGATAAATAAAAAACCAAACTTGGATTTGTAGCTTGCTTTGTG
TTGCGGCACCATGGAGGACCCCAATCGCATGTTGGCCCACACCGGCGGCA
TGATGGCTCCGCAAGGATACGGCTTGTCTGGCCAGGATGATGGCCAGAAT
GCCGGCAGCGAGAACGAGGTGCGCAAGCAGAAGGACATCGGCGAGATATT
GCAACAGATAATGAGTATCTCGGAGCAATCACTTGACGAGGCCCAGGCCA
GAAAACATACACTAAACTGTCACCGAATGAAGCCGGCACTTTTCTCTGTA
CTTTGCGAAATCAAGGAGAAGACCGTCCTCTCGATTCGCAACACCCAGGA
GGAGGAGCCCCCAGATCCGCAACTGATGCGCTTGGACAACATGCTGATTG
CCGAGGGCGTGGCCGGACCCGAGAAGGGCGGTGGCGGAGCAGCGGCTGCC
TCTGCGGCTGCGGCCAGCCAGGGCGGTTCCCTGTCCATCGATGGTGCTGA
CAATGCCATTGAGCATTCCGACTACCGTGCCAAGCTGGCACAGATCCGTC
AAATATATCACCAGGAATTGGAGAAGTACGAGCAGGCATGCAACGAGTTC
ACCACGCATGTCATGAATCTTCTACGCGAACAGAGTCGCACGAGACCCAT
TACACCAAAGGAAATCGAGCGAATGGTGCAGATCATCCACAAAAAGTTTA
GTTCCATACAAATGCAGCTGAAGCAGTCGACCTGCGAGGCTGTAATGATA
CTTCGTTCGCGTTTCCTGGACGCACGCCGCAAACGCCGCAATTTCAGCAA
GCAGGCATCCGAGATTCTCAACGAGTACTTCTACAGTCACTTGAGCAACC
CATATCCATCCGAAGAGGCCAAAGAGGAGTTGGCACGAAAGTGTGGCATC
ACGGTCTCGCAAGTATCGAATTGGTTTGGCAACAAGCGTATTCGCTATAA
GAAGAACATTGGTAAGGCACAGGAGGAGGCCAATTTGTATGCGGCCAAGA
AGGCGGCTGGTGCTTCACCGTATTCCATGGCCGGTCCACCCAGCGGGACA
ACCACACCCATGATGTCACCCGCTCCGCCACAGGATTCCATGGGCTATCC
AATGGGCTCCGGCGGATACGACCAGCAGCAACCGTACGACAACAGCATGG
GCGGCTACGACCCAAATCTCCATCAGGATCTAAGCCCCTGAGGATCAGGG
CTGTGAACCACTCCCAGTCCGGAGAATCCCTCATACAGTTGCGGTCAAAA
TAACTGCGCTGAAAAATCTAACATGCAGTTTTTTCATAATTATGCGGCTT
ATATTTGCTTCTTCGCCAAGAACAACAATTCTTAAGGGATTTTTAAATTC
AGCTTTCTGTCCTTTGGTTTCGAGTCAGATAAGTTTAAAATTCCCATCAA
TTTAGATATAGTTCCGATAGATATACATAAATACGTGAGTAGAATATAAA
TACGTAATAGTTAGTTTGTGCTTGCTACATTTTGGTTGGCAGAAAAAACT
TTGCCTGCTTAAATCAAAAAAGAAAGTAAATAAGCTGATATGGTTTTTTA
ATTGACACAGTCTCCTGCTTTTTAACAATATATGCATGCAGGATGTATTA
AGAAGTCGACAATTGAATAATGGCCTAATTAAGAATATTTTTTGCCCGAA
CATAAAACGAAAAGTTTGCTCGCTTTTTTTTTTTTAATTCACAATCAATT
GAAATGGAAAGCATGTTGTTTGTGGCATGTCAACTGTAAAATACATAAAT
ACGTAATAATTCGCTTAAGCGATTATAATTTGATCAACGTTCTTTAAAAA
GGGTTAATAACCAATGCAGTGACTTTTTCTGCATAGCCCCATTTAGCTTA
TATATTAACCATCGAAAACATATGCAAAGAAACTCGATTAAACTGGTAGT
ATACGAATATTTTCACAACGAGTGGAGGAGGCACAAGTTTCAGAGCTATT
ATTTTGACCGCAGCTGTGTATAAATATATTTTAATACATTTACCTACATT
TGCGGGTATATACAAATATTGCATGTAAATCATACTATGACGATTCTTTT
TTGGCTACAGTACGTATACGACAGCAAAATAGTGTTTACTGAATTTAAAA
CTGTACGAAATTTTTAAAAACTTGAACAATACGAAAATACGAAACTAAAC
CATGTATACGATGTATATCAAATAAATAAATAATACATGTTGTTGTTATC
CGCACACACGTCAACTAAAAAAAAAAAAAAAAA

LD03509.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
exd.k 2934 exd.k 45..2409 53..2418 11790 99.9 Plus
exd-RA 2575 exd-RA 45..2409 53..2418 11790 99.9 Plus
exd.l 2939 exd.l 45..2409 53..2418 11790 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15884532..15885844 1103..2416 6490 99.8 Plus
chrX 22417052 chrX 15883812..15884131 525..844 1600 100 Plus
chrX 22417052 chrX 15883320..15883621 224..525 1510 100 Plus
chrX 22417052 chrX 15884193..15884455 843..1105 1300 99.6 Plus
chrX 22417052 chrX 15882331..15882501 53..223 855 100 Plus
chrXHet 204175 chrXHet 184209..184260 52..1 260 100 Minus
chrU 10048995 chrU 3653453..3653504 1..52 260 100 Plus
chrU 10048995 chrU 6962031..6962082 52..1 260 100 Minus
chrU 10048995 chrU 9460929..9460980 1..52 260 100 Plus
chrU 10048995 chrU 9488321..9488372 1..52 260 100 Plus
chrU 10048995 chrU 9844347..9844398 1..52 260 100 Plus
chrU 10048995 chrU 10000230..10000281 1..52 260 100 Plus
chrU 10048995 chrU 10004064..10004115 52..1 260 100 Minus
chrU 10048995 chrU 10029502..10029553 52..1 260 100 Minus
chrXHet 204175 chrXHet 192843..192891 49..1 245 100 Minus
chrU 10048995 chrU 3557235..3557286 52..1 245 98.1 Minus
chrU 10048995 chrU 3924058..3924106 1..49 245 100 Plus
chrU 10048995 chrU 9115888..9115939 1..52 245 98.1 Plus
chrU 10048995 chrU 7541000..7541046 47..1 235 100 Minus
chrU 10048995 chrU 7713705..7713750 1..46 230 100 Plus
chrU 10048995 chrU 9502855..9502901 47..1 220 97.9 Minus
chrU 10048995 chrU 6673812..6673857 46..1 215 97.8 Minus
chrU 10048995 chrU 7844596..7844642 1..47 205 95.7 Plus
chrU 10048995 chrU 9239180..9239226 1..47 190 93.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RE 1131 CG8933-PE 1..1131 261..1391 5655 100 Plus
exd-RD 1131 CG8933-PD 1..1131 261..1391 5655 100 Plus
exd-RA 1131 CG8933-PA 1..1131 261..1391 5655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
5.8SrRNA:CR40454-RA 123 CR40454-RA 71..122 52..1 260 100 Minus
CR41620-RA 524 CR41620-RA 298..349 52..1 260 100 Minus
CR40743-RA 530 CR40743-RA 296..347 52..1 260 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RA 2386 CG8933-RA 24..2386 53..2416 11770 100 Plus
exd-RE 2883 CG8933-RE 179..2370 224..2416 10915 100 Plus
exd-RD 2930 CG8933-RD 226..2417 224..2416 10915 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
exd-PE 376 CG8933-PE 1..376 261..1388 1628 100 Plus
exd-PD 376 CG8933-PD 1..376 261..1388 1628 100 Plus
exd-PA 376 CG8933-PA 1..376 261..1388 1628 100 Plus
exd-PB 376 CG8933-PB 1..376 261..1388 1628 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15994684..15995998 1103..2418 6530 99.9 Plus
X 23542271 X 15993964..15994283 525..844 1600 100 Plus
X 23542271 X 15993472..15993773 224..525 1510 100 Plus
X 23542271 X 15994345..15994607 843..1105 1315 100 Plus
X 23542271 X 15992491..15992661 53..223 855 100 Plus
X 23542271 X 23205328..23205379 52..1 260 100 Minus
X 23542271 X 23280156..23280207 1..52 260 100 Plus
rDNA 76973 rDNA 46275..46326 52..1 260 100 Minus
rDNA 76973 rDNA 58724..58775 52..1 260 100 Minus
rDNA 76973 rDNA 70459..70510 52..1 260 100 Minus
U 3151297 U 1671354..1671405 52..1 260 100 Minus
XYmm 216041 XYmm 145189..145240 1..52 260 100 Plus
XYmm 216041 XYmm 155112..155163 1..52 260 100 Plus
XYmm 216041 XYmm 163369..163420 52..1 260 100 Minus
Xmm 1049845 Xmm 365844..365895 52..1 260 100 Minus
X 23542271 X 23213962..23214010 49..1 245 100 Minus
X 23542271 X 23291622..23291670 49..1 245 100 Minus
X 23542271 X 23439670..23439721 52..1 245 98.1 Minus
X 23542271 X 23538063..23538114 1..52 245 98.1 Plus
rDNA 76973 rDNA 16445..16496 52..1 245 98.1 Minus
XYmm 216041 XYmm 167139..167190 1..52 245 98.1 Plus
XYmm 216041 XYmm 126695..126741 47..1 235 100 Minus
XYmm 216041 XYmm 147224..147269 1..46 230 100 Plus
U 3151297 U 2754598..2754644 47..1 220 97.9 Minus
U 3151297 U 2882296..2882341 46..1 215 97.8 Minus
XYmm 216041 XYmm 128866..128912 1..47 205 95.7 Plus
XYmm 216041 XYmm 135633..135679 1..47 190 93.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16002782..16004096 1103..2418 6540 99.9 Plus
X 23527363 X 16002062..16002381 525..844 1600 100 Plus
X 23527363 X 16001570..16001871 224..525 1510 100 Plus
X 23527363 X 16002443..16002705 843..1105 1315 100 Plus
X 23527363 X 16000589..16000759 53..223 855 100 Plus
X 23527363 X 23265248..23265299 1..52 260 100 Plus
X 23527363 X 23190420..23190471 52..1 260 100 Minus
X 23527363 X 23523155..23523206 1..52 245 98 Plus
X 23527363 X 23276714..23276762 49..1 245 100 Minus
X 23527363 X 23199054..23199102 49..1 245 100 Minus
X 23527363 X 23424762..23424813 52..1 245 98 Minus
Unimproved_211000022218214_223_728 505 Unimproved_211000022218214_223_728 208..252 45..1 225 100 Minus
Unimproved_211000022231095_101_671 570 Unimproved_211000022231095_101_671 173..218 46..1 215 97.8 Minus
Blast to na_te.dros performed on 2014-11-27 05:03:45 has no hits.

LD03509.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:27:23 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15884533..15885844 1104..2416 99   Plus
chrX 15884195..15884453 845..1103 99 -> Plus
chrX 15883813..15884131 526..844 100 -> Plus
chrX 15883320..15883621 224..525 100 -> Plus
chrX 15882327..15882501 46..223 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:47 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 1..1131 261..1391 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:47:14 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 1..1131 261..1391 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:34 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 1..1131 261..1391 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:02 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 1..1131 261..1391 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:23 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 1..1131 261..1391 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:50:04 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
CR40743-RA 291..347 1..59 94   Minus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:30:59 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 1..2367 49..2416 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:47:14 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 1..2367 49..2416 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:34 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 20..2386 46..2416 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:02 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 1..2367 49..2416 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:23 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 20..2386 46..2416 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:27:23 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
X 15994685..15995996 1104..2416 99   Plus
X 15994347..15994605 845..1103 100 -> Plus
X 15993965..15994283 526..844 100 -> Plus
X 15993472..15993773 224..525 100 -> Plus
X 15992487..15992661 46..223 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:34 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15888718..15890029 1104..2416 99   Plus
arm_X 15888380..15888638 845..1103 100 -> Plus
arm_X 15887998..15888316 526..844 100 -> Plus
arm_X 15887505..15887806 224..525 100 -> Plus
arm_X 15886520..15886694 46..223 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:52 Download gff for LD03509.complete
Subject Subject Range Query Range Percent Splice Strand
X 16002783..16004094 1104..2416 99   Plus
X 16002445..16002703 845..1103 100 -> Plus
X 16002063..16002381 526..844 100 -> Plus
X 16001570..16001871 224..525 100 -> Plus
X 16000585..16000759 46..223 98 -> Plus

LD03509.pep Sequence

Translation from 260 to 1390

> LD03509.pep
MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQI
MSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEP
PDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAI
EHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPK
EIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQAS
EILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
GKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGS
GGYDQQQPYDNSMGGYDPNLHQDLSP*

LD03509.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20172-PA 376 GF20172-PA 1..376 1..376 1998 98.1 Plus
Dana\GF17520-PA 487 GF17520-PA 366..422 239..295 157 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17938-PA 376 GG17938-PA 1..376 1..376 2025 100 Plus
Dere\GG17283-PA 487 GG17283-PA 366..422 239..295 157 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17639-PA 374 GH17639-PA 1..374 1..376 1887 98.7 Plus
Dgri\GH19106-PA 456 GH19106-PA 335..391 239..295 157 47.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
exd-PE 376 CG8933-PE 1..376 1..376 1953 100 Plus
exd-PD 376 CG8933-PD 1..376 1..376 1953 100 Plus
exd-PA 376 CG8933-PA 1..376 1..376 1953 100 Plus
exd-PB 376 CG8933-PB 1..376 1..376 1953 100 Plus
hth-PA 472 CG17117-PA 351..457 239..372 155 30.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16078-PA 375 GI16078-PA 1..375 1..376 1874 98.4 Plus
Dmoj\GI23559-PA 472 GI23559-PA 351..407 239..295 157 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10055-PA 266 GL10055-PA 1..266 111..376 1423 99.6 Plus
Dper\GL15332-PA 89 GL15332-PA 1..88 1..88 456 95.5 Plus
Dper\GL23828-PA 266 GL23828-PA 145..201 239..295 155 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21419-PA 376 GA21419-PA 1..376 1..376 2003 98.7 Plus
Dpse\GA14330-PG 471 GA14330-PG 350..406 239..295 157 47.4 Plus
Dpse\GA14330-PB 471 GA14330-PB 350..406 239..295 157 47.4 Plus
Dpse\GA14330-PD 460 GA14330-PD 339..395 239..295 157 47.4 Plus
Dpse\GA14330-PH 217 GA14330-PH 96..152 239..295 155 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11678-PA 376 GM11678-PA 1..376 1..376 2025 100 Plus
Dsec\GM26167-PA 487 GM26167-PA 366..422 239..295 157 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17261-PA 376 GD17261-PA 1..376 1..376 2025 100 Plus
Dsim\GD20718-PA 487 GD20718-PA 366..422 239..295 157 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15726-PA 374 GJ15726-PA 1..374 1..376 1887 98.7 Plus
Dvir\GJ15917-PA 374 GJ15917-PA 1..374 1..376 1871 97.9 Plus
Dvir\GJ23538-PA 470 GJ23538-PA 349..405 239..295 158 47.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20113-PA 376 GK20113-PA 1..376 1..376 2012 99.2 Plus
Dwil\GK22581-PA 486 GK22581-PA 365..421 239..295 157 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17244-PA 375 GE17244-PA 1..375 1..376 1908 99.7 Plus
Dyak\GE24684-PA 487 GE24684-PA 366..422 239..295 157 47.4 Plus

LD03509.hyp Sequence

Translation from 260 to 1390

> LD03509.hyp
MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQI
MSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEP
PDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAI
EHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPK
EIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQAS
EILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
GKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGS
GGYDQQQPYDNSMGGYDPNLHQDLSP*

LD03509.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
exd-PE 376 CG8933-PE 1..376 1..376 1953 100 Plus
exd-PD 376 CG8933-PD 1..376 1..376 1953 100 Plus
exd-PA 376 CG8933-PA 1..376 1..376 1953 100 Plus
exd-PB 376 CG8933-PB 1..376 1..376 1953 100 Plus
hth-PA 472 CG17117-PA 351..457 239..372 155 30.6 Plus