Clone LD04613 Report

Search the DGRC for LD04613

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:46
Well:13
Vector:pBS SK-
Associated Gene/Transcriptltd-RC
Protein status:LD04613.pep: gold
Preliminary Size:2538
Sequenced Size:2389

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8024 2001-01-01 Release 2 assignment
CG8024 2001-11-09 Blastp of sequenced clone
CG8024 2003-01-01 Sim4 clustering to Release 3
ltd 2008-04-29 Release 5.5 accounting
ltd 2008-08-15 Release 5.9 accounting
ltd 2008-12-18 5.12 accounting

Clone Sequence Records

LD04613.complete Sequence

2389 bp (2389 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069328

> LD04613.complete
TCTCGAGTTTTGTTTTTTTTTTCGGTTCAGTTATAAACTGAAATTACTGG
AGGTCGGACGTCTCGAGGCTCGGAATCACTGTTGTTGTTGTTTTGCGCCG
TCTTGGCTCGTGTTGTTGTTGTCTTGCGTAGTATTGCGTGCCTGGAAATC
GAACGTGTGTGAATTTAATTTACGATTCGTATAATTATCAGCAAGAGCAA
ACAATATAAGTTGCAAACGACCGTTTAAGCCCTATGACACTAAGATCCAA
AGTAAGTGGCTACCACCGAACTGTTCCATTTGCATTTGAAACCAGTTTCC
AGCGATTCGAGTGCATGAAATTGTCCAAAAAAGTGCAACGGTCGAGTTCA
ACAAACCGATCGATTGAGATAACACCGCAAATATATAGCTGTGAAACTCG
CAAATAAATACCTACATATTCTTCTGATAAGTTCAAGAACAGTCTAGCCA
TTGTTTACCGTTAGACCAGAACCACATGTTGCTCGGGATCCGCGTTCCGA
AGAGCGAGAGTTATACGTCTGTGCCTGGAGAGGGCCACTAGAGCGCGTGT
GAACGACCTTGACTGGGCGGGGGCGTTAGATAACTGCGGAGAAGGTCTAA
AGATCACACTCACCCACCCCGTATCGGTGGTTGCATGGCAACCGGCGTCA
TCCAGAGTAGCGTTGTCTCCACCTCCGCCGGACGCCAGAATATCTGCGAC
TGCCTGGAACAGGAGTCCGCCGGATTGGTCAAGGCCCTGCCCAAATCCAA
GTCGGCCGATCAGCTCTCGGAACTCACCTGCGCCTGCCTGCGCTGCCAGT
ACCTGGCCACGGATCTTCAGCATCCGAACACCCAGTCCGGTCACCTGCCC
GTGGAGCACAGACACCGACCCGTGAGCTCAGGCTCCGGTTCACTGGGCGC
CCTCAGCGCCAAGGAGTCGCCCATCTTCGTGCGCCGCCAGATCTGTTTCC
CGTCCGCGGAGACCCAGCTGCATCCGCCGCTCAGCTCCTCCCAGTTCTCG
CTGCGAAGTGCTTCTCCGGCCTACGCCGAGCCCAAGCCGGAGTTGGATCT
CGGCGCCATAGAGGCGCTGCAACTGACCACGGTCATGCCCGCGGGAGTCA
ACCGTAACCACATGGACATCAACAGGAACAACGGATACCTGCACAACGGA
GCCATCATGACATCCACCAGCGATAAGCGCGAGCATCTGTACAAGATTCT
AGTCATTGGTGAACTGGGCACCGGCAAGACGTCCTTCATTAAGCGCTATG
TGCACCAGTTCTTCAGCCAGAACTACAGGGCCACCATCGGCGTGGACTTC
GCCCTGAAAGTGCTGCAGTGGGACGCCAATACGATAGTGCGCCTCCAGCT
GTGGGATATCGCCGGTCAGGAGAGGTTTGGCAACATGACCCGTGTCTACT
ACAAGGAGGCGGTGGGCGCGTTCATCGTTTTTGATGTGACTCGCAGTGGG
ACTTTCGATTGCGTGAGCAAGTGGAAGGAAGATCTAGACTCCAAGGTGCA
GCTGCCGGACGGCAGTCCCATTCCGTGCATCCTGCTGGCCAATAAATGCG
ACCAGGAAAAGCAGGGCATCATAACGCAGCCCGAGAAGATGGATGAGTAT
GTGAGGGAGAACGGATTTGCCGGTTGGTTTGAGACATCCGCCAAGGAGAA
TATCAACATCGATGAGGCAGCTCGTGCCCTCGTGAATAAGATACTCATCA
ACGATAAGCTGATATCTGCCGATCTGGCCGATGGCGACAAGTTCAACTTG
AGCGCGGCCGATGCAACCGGATCGGATGCCAAGAACAAGTGTTCCTGCTG
ACCTGGGACCGAGGTCCGGCGACTCCTATTCCCATTCCCAGTTTAAGAGC
GAGTTTCAACACAGAAACGCCATGTGCCTACGTCCACTCCATGTTCATGT
TGTTAGAAGATAGCGATAACTATGCTTAGGGTTTTAACGTAACATTTGTC
TAAGACTTAGTGTCATCCGTATCATCCCGTCCGTCTTTATCTTTAACACC
CCGTCTGTGGGTCCACAATGTTGCGCCGGCATCGGGATCCGTGTCACTTT
GAGAATTTATATGGTGACACATAACATACCTACGCATACGAAACATTATT
ACTATCACCATCATTGCCCTAGTTGCGAGGATTAGCCGGAGGTAGTGCAG
CATCCGTATCATAGCATACTACATTTGTGTAAAATGCGAATCGTCTTATT
GTTTTGTTTGTTTTATTTGCCTCTGCTGGCGAGATTGTTTTATCTTGGAA
TTATTATTCTCGTATGCAAACACACTCTGCCATCATTATTTGTATTTAGA
TAACAATACGTACGCTTAATGCAATGCGAAATCAGAAATAAAGTTTTTAA
TGGTAGTTAAGTTCAAAAAAAAAAAAAAAAAAAAAAAAA

LD04613.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 2441 ltd-RC 1..2360 6..2365 11755 99.8 Plus
ltd-RE 2152 ltd-RE 224..2146 443..2365 9615 100 Plus
ltd.a 2013 ltd.a 85..2007 443..2365 9615 100 Plus
ltd-RE 2152 ltd-RE 1..223 29..251 1115 100 Plus
ltd.a 2013 ltd.a 23..84 190..251 310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5072782..5073927 1151..6 5625 99.4 Minus
chr2R 21145070 chr2R 5065437..5066112 2364..1689 3365 99.9 Minus
chr2R 21145070 chr2R 5066396..5066791 1546..1151 1980 100 Minus
chr2R 21145070 chr2R 5066172..5066315 1690..1547 720 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 1167 CG8024-PC 1..1167 635..1801 5835 100 Plus
ltd-RE 1167 CG8024-PE 1..1167 635..1801 5835 100 Plus
ltd-RD 669 CG8024-PD 18..669 1150..1801 3260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 2347 CG8024-RC 1..2340 25..2364 11700 100 Plus
ltd-RE 2156 CG8024-RE 228..2149 443..2364 9610 100 Plus
ltd-RD 1448 CG8024-RD 227..1441 1150..2364 6075 100 Plus
ltd-RE 2156 CG8024-RE 1..227 25..251 1135 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-PC 388 CG8024-PC 1..388 635..1798 1857 100 Plus
ltd-PE 388 CG8024-PE 1..388 635..1798 1857 100 Plus
ltd-PD 222 CG8024-PD 3..222 1139..1798 1129 98.6 Plus
ltd-PJ 214 CG8024-PJ 1..214 1157..1798 1118 100 Plus
ltd-PH 214 CG8024-PH 1..214 1157..1798 1118 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9185216..9186361 1151..6 5685 99.7 Minus
2R 25286936 2R 9177870..9178546 2365..1689 3385 100 Minus
2R 25286936 2R 9178830..9179225 1546..1151 1980 100 Minus
2R 25286936 2R 9178606..9178749 1690..1547 720 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9186415..9187560 1151..6 5685 99.7 Minus
2R 25260384 2R 9179069..9179745 2365..1689 3385 100 Minus
2R 25260384 2R 9180029..9180424 1546..1151 1980 100 Minus
2R 25260384 2R 9179805..9179948 1690..1547 720 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:17:35 has no hits.

LD04613.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:06:25 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5072783..5073908 25..1150 99 <- Minus
chr2R 5066396..5066791 1151..1546 100 <- Minus
chr2R 5066172..5066315 1547..1690 100 <- Minus
chr2R 5065437..5066110 1691..2364 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:35:10 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..1167 635..1801 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:09 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..1167 635..1801 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:43 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 1..1167 635..1801 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:33 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..1167 635..1801 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:06:25 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 1..1167 635..1801 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:30 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..2359 6..2364 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:09 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..2359 6..2364 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:43 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..2340 25..2364 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:33 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..2359 6..2364 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:06:25 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..2340 25..2364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:06:25 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9185217..9186342 25..1150 100 <- Minus
2R 9178830..9179225 1151..1546 100 <- Minus
2R 9178606..9178749 1547..1690 100 <- Minus
2R 9177871..9178544 1691..2364 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:43 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5072722..5073847 25..1150 100 <- Minus
arm_2R 5066335..5066730 1151..1546 100 <- Minus
arm_2R 5066111..5066254 1547..1690 100 <- Minus
arm_2R 5065376..5066049 1691..2364 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:09 Download gff for LD04613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9186416..9187541 25..1150 100 <- Minus
2R 9180029..9180424 1151..1546 100 <- Minus
2R 9179805..9179948 1547..1690 100 <- Minus
2R 9179070..9179743 1691..2364 100 <- Minus

LD04613.pep Sequence

Translation from 634 to 1800

> LD04613.pep
MATGVIQSSVVSTSAGRQNICDCLEQESAGLVKALPKSKSADQLSELTCA
CLRCQYLATDLQHPNTQSGHLPVEHRHRPVSSGSGSLGALSAKESPIFVR
RQICFPSAETQLHPPLSSSQFSLRSASPAYAEPKPELDLGAIEALQLTTV
MPAGVNRNHMDINRNNGYLHNGAIMTSTSDKREHLYKILVIGELGTGKTS
FIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN
MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCIL
LANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALV
NKILINDKLISADLADGDKFNLSAADATGSDAKNKCSC*

LD04613.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 13:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12008-PA 405 GF12008-PA 1..405 1..388 1705 80.1 Plus
Dana\GF10872-PA 219 GF10872-PA 19..184 183..353 296 38.2 Plus
Dana\GF20241-PA 204 GF20241-PA 9..171 185..354 295 36.5 Plus
Dana\GF14883-PA 239 GF14883-PA 25..239 175..388 287 33.8 Plus
Dana\GF11093-PA 220 GF11093-PA 19..186 183..359 286 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 13:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10573-PA 414 GG10573-PA 1..414 1..388 1947 88.4 Plus
Dere\GG14295-PA 219 GG14295-PA 19..184 183..353 317 39.3 Plus
Dere\GG19277-PA 204 GG19277-PA 9..171 185..354 294 36.5 Plus
Dere\GG22724-PA 220 GG22724-PA 19..186 183..359 286 35.6 Plus
Dere\GG13365-PA 207 GG13365-PA 6..169 183..353 281 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 13:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19866-PA 664 GH19866-PA 450..664 174..388 1057 90.2 Plus
Dgri\GH19866-PA 664 GH19866-PA 1..150 1..172 298 45.7 Plus
Dgri\GH15503-PA 219 GH15503-PA 16..184 180..353 296 38.1 Plus
Dgri\GH24197-PA 220 GH24197-PA 19..220 183..388 289 33.6 Plus
Dgri\GH12621-PA 204 GH12621-PA 9..171 185..354 288 35.9 Plus
Dgri\GH24326-PA 201 GH24326-PA 6..176 183..362 282 36.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-PC 388 CG8024-PC 1..388 1..388 2016 100 Plus
ltd-PE 388 CG8024-PE 1..388 1..388 2016 100 Plus
ltd-PD 222 CG8024-PD 3..222 169..388 1129 98.6 Plus
ltd-PJ 214 CG8024-PJ 1..214 175..388 1118 100 Plus
ltd-PH 214 CG8024-PH 1..214 175..388 1118 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 13:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19816-PA 665 GI19816-PA 452..665 174..388 1097 91.6 Plus
Dmoj\GI19816-PA 665 GI19816-PA 1..186 1..181 323 44.9 Plus
Dmoj\GI16780-PA 219 GI16780-PA 19..184 183..353 304 38.2 Plus
Dmoj\GI11034-PA 204 GI11034-PA 9..171 185..354 290 35.9 Plus
Dmoj\GI20173-PA 220 GI20173-PA 19..186 183..359 286 35.6 Plus
Dmoj\GI14806-PA 201 GI14806-PA 6..199 183..386 283 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 13:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17459-PA 931 GL17459-PA 715..931 173..388 1145 94.5 Plus
Dper\GL17459-PA 931 GL17459-PA 1..179 1..179 409 53.3 Plus
Dper\GL22545-PA 219 GL22545-PA 19..184 183..353 316 38.7 Plus
Dper\GL17187-PA 220 GL17187-PA 19..186 183..359 286 35.6 Plus
Dper\GL15675-PA 207 GL15675-PA 6..169 183..353 281 33.3 Plus
Dper\GL21269-PA 239 GL21269-PA 25..239 175..388 281 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 13:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20772-PB 389 GA20772-PB 1..389 1..388 1564 78.2 Plus
Dpse\GA20772-PC 726 GA20772-PC 510..726 173..388 1152 94.5 Plus
Dpse\GA20772-PD 215 GA20772-PD 1..215 175..388 1104 94.4 Plus
Dpse\GA20071-PA 219 GA20071-PA 19..184 183..353 316 38.7 Plus
Dpse\GA26078-PA 204 GA26078-PA 9..171 185..354 289 35.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 13:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20620-PA 382 GM20620-PA 167..382 173..388 1182 99.5 Plus
Dsec\GM20619-PA 173 GM20619-PA 1..172 1..172 883 94.8 Plus
Dsec\GM25038-PA 219 GM25038-PA 19..184 183..353 318 39.3 Plus
Dsec\GM23016-PA 204 GM23016-PA 9..171 185..354 294 36.5 Plus
Dsec\GM20500-PA 220 GM20500-PA 19..186 183..359 286 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 13:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10095-PA 382 GD10095-PA 167..382 173..388 1182 99.5 Plus
Dsim\GD10093-PA 173 GD10093-PA 1..172 1..172 897 96.5 Plus
Dsim\GD14074-PA 219 GD14074-PA 19..184 183..353 317 39.3 Plus
Dsim\GD12244-PA 207 GD12244-PA 6..169 183..353 281 33.3 Plus
Dsim\GD15551-PA 201 GD15551-PA 6..169 183..354 275 33.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 13:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18542-PA 660 GJ18542-PA 447..660 174..388 1063 91.6 Plus
Dvir\GJ18542-PA 660 GJ18542-PA 1..178 1..172 321 46 Plus
Dvir\GJ12523-PA 220 GJ12523-PA 19..184 183..353 303 38.2 Plus
Dvir\GJ15815-PA 204 GJ15815-PA 9..202 185..386 296 34 Plus
Dvir\GJ20130-PA 220 GJ20130-PA 19..220 183..388 291 33.6 Plus
Dvir\GJ19473-PA 201 GJ19473-PA 6..199 183..386 286 33.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 13:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22864-PA 685 GK22864-PA 469..685 173..388 1124 94.5 Plus
Dwil\GK17190-PA 219 GK17190-PA 19..184 183..353 312 38.2 Plus
Dwil\GK22864-PA 685 GK22864-PA 15..169 16..172 304 51.8 Plus
Dwil\GK25049-PA 204 GK25049-PA 9..171 185..354 295 36.5 Plus
Dwil\GK19661-PA 220 GK19661-PA 19..186 183..359 286 35.6 Plus
Dwil\GK16335-PA 200 GK16335-PA 6..176 183..362 283 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 13:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22467-PA 560 GE22467-PA 345..560 173..388 1177 98.6 Plus
Dyak\GE22467-PA 560 GE22467-PA 1..167 1..167 796 88 Plus
Dyak\GE20724-PA 219 GE20724-PA 19..184 183..353 317 39.3 Plus
Dyak\GE17866-PA 204 GE17866-PA 9..171 185..354 294 36.5 Plus
Dyak\GE19031-PA 239 GE19031-PA 8..239 155..388 292 33.1 Plus
Dyak\GE13081-PA 220 GE13081-PA 19..186 183..359 286 35.6 Plus

LD04613.hyp Sequence

Translation from 634 to 1800

> LD04613.hyp
MATGVIQSSVVSTSAGRQNICDCLEQESAGLVKALPKSKSADQLSELTCA
CLRCQYLATDLQHPNTQSGHLPVEHRHRPVSSGSGSLGALSAKESPIFVR
RQICFPSAETQLHPPLSSSQFSLRSASPAYAEPKPELDLGAIEALQLTTV
MPAGVNRNHMDINRNNGYLHNGAIMTSTSDKREHLYKILVIGELGTGKTS
FIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN
MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCIL
LANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALV
NKILINDKLISADLADGDKFNLSAADATGSDAKNKCSC*

LD04613.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-PC 388 CG8024-PC 1..388 1..388 2016 100 Plus
ltd-PE 388 CG8024-PE 1..388 1..388 2016 100 Plus
ltd-PD 222 CG8024-PD 3..222 169..388 1129 98.6 Plus
ltd-PJ 214 CG8024-PJ 1..214 175..388 1118 100 Plus
ltd-PH 214 CG8024-PH 1..214 175..388 1118 100 Plus