Clone LD06016 Report

Search the DGRC for LD06016

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:60
Well:16
Vector:pBS SK-
Associated Gene/TranscriptCG7818-RA
Protein status:LD06016.pep: gold
Preliminary Size:1606
Sequenced Size:1433

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7818 2001-01-01 Release 2 assignment
CG7818 2001-11-09 Blastp of sequenced clone
CG7818 2003-01-01 Sim4 clustering to Release 3
CG7818 2008-04-29 Release 5.5 accounting
CG7818 2008-08-15 Release 5.9 accounting
CG7818 2008-12-18 5.12 accounting

Clone Sequence Records

LD06016.complete Sequence

1433 bp (1433 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069354

> LD06016.complete
AGACGGCAAATTTTGTTGTCTTTAATTTTTAGTTTTCTTAAAATTGCGAT
TTAAAATATAGTACAGTACGTTTTTACTGCATATATTAGTATGAGCGATG
TGCTAAAGAGCTCCCAGGAGCGATCCCGCAAGCGTCGTTTGCTTTTAGCG
CAAACTTTGGGCTTGTCGAGCGTCGACGATCTGAAAAAGGCTTTGGGTAA
TGCCGAAGACATTAACAGTAGTCGCCAGCTGAATTCCGGTGGGCAACGCG
AGGAGGAGGATGGTGGCGCCTCTTCCTCCAAGAAAACCCCCAATGAAATC
ATCTATAGGGACTCCTCGACCTTCCTGAAGGGAACCCAGTCTTCCAATCC
GCACAATGACTACTGCCAGCACTTTGTGGACACCGGTCAGCGTCCCCAGA
ACTTCATCCGTGATGTCGGCCTAGCTGACCGCTTCGAGGAGTATCCCAAG
TTGAGGGAACTGATCAAACTGAAGGACAAACTCATCCAAGACACCGCATC
CGCACCTATGTACTTAAAGGCGGATCTGAAATCGCTAGATGTCAAGACGC
TGGGCGCCAAGTTTGATGTTATTTTGATTGAGCCGCCGCTAGAGGAATAT
GCCAGGGCAGCACCTTCTGTAGCCACTGTAGGTGGGGCACCGCGGGTTTT
CTGGAACTGGGATGATATACTTAATTTGGATGTGGGCGAGATAGCTGCTC
ATCGTTCGTTTGTATTCCTTTGGTGCGGATCCTCGGAGGGCTTGGACATG
GGCCGCAACTGCCTGAAGAAGTGGGGATTCCGGAGGTGCGAAGACATATG
TTGGATACGGACCAACATTAACAAGCCCGGGCACTCCAAGCAACTTGAAC
CGAAAGCGGTCTTTCAACGCACCAAGGAACACTGCCTGATGGGAATCAAA
GGAACTGTTCGCCGCTCCACTGATGGCGATTTTATCCATGCCAACGTGGA
CATTGATTTAATCATCTCAGAGGAAGAGGAGTTTGGCAGCTTCGAGAAGC
CCATCGAGATCTTTCACATCATCGAACATTTCTGCTTGGGTCGACGGCGT
TTGCATCTGTTCGGCAGAGATTCGAGTATTCGACCAGGTTGGCTAACTGT
TGGTCCGGAACTGACGAACTCGAACTTCAACTCCGAGCTATACCAGACCT
ACTTTGCTGAGGCTCCAGCCACCGGTTGCACTAGTAGGATTGAACTACTG
AGGCCCAAGAGTCCGCCGCCGAATAGCAAAGTTTTAAGAGGAAGAGGACG
CGGCTTTCCACGTGGTCGTGGAAGGCCCAGATAACAGCATTTTTACTCAA
CAACTGCGTGTATTCTAGTGTCTAAGATCAAAAGTTTTTAAGGCTAAGAA
TAAGATTAACATTAAAGTCTATTGCTGCAGAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD06016.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1532 CG7818-RA 128..1509 1..1382 6910 100 Plus
CG7810-RA 1276 CG7810-RA 1182..1276 1382..1288 475 100 Minus
CG7810.a 1283 CG7810.a 1189..1283 1382..1288 475 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8308183..8308889 674..1380 3370 98.4 Plus
chr2L 23010047 chr2L 8307610..8308126 157..673 2525 99.2 Plus
chr2L 23010047 chr2L 8307382..8307537 1..156 750 98.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1194 CG7818-PA 1..1194 91..1284 5970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1407 CG7818-RA 28..1407 1..1380 6900 100 Plus
CG7810-RA 1320 CG7810-RA 1235..1320 1380..1295 430 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 397 CG7818-PA 1..382 91..1236 1941 100 Plus
Ime4-PA 608 CG5933-PA 385..594 493..1185 242 29.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8309255..8309963 674..1382 3545 100 Plus
2L 23513712 2L 8308682..8309198 157..673 2585 100 Plus
2L 23513712 2L 8308454..8308609 1..156 780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8309255..8309963 674..1382 3545 100 Plus
2L 23513712 2L 8308682..8309198 157..673 2585 100 Plus
2L 23513712 2L 8308454..8308609 1..156 780 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:00:13 has no hits.

LD06016.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:58:53 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8308183..8308889 674..1380 98   Plus
chr2L 8307610..8308126 157..673 99 -> Plus
chr2L 8307382..8307537 1..156 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:37:48 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 91..1284 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:30:32 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 91..1284 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:07 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 91..1284 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:58:09 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 91..1284 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:53 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 91..1284 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:08:32 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 15..1394 1..1380 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:30:32 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 15..1394 1..1380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:07 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 28..1407 1..1380 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:58:10 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 15..1394 1..1380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:53 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 28..1407 1..1380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:58:53 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8309255..8309961 674..1380 100   Plus
2L 8308682..8309198 157..673 100 -> Plus
2L 8308454..8308609 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:07 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8309255..8309961 674..1380 100   Plus
arm_2L 8308682..8309198 157..673 100 -> Plus
arm_2L 8308454..8308609 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:34:33 Download gff for LD06016.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8309255..8309961 674..1380 100   Plus
2L 8308682..8309198 157..673 100 -> Plus
2L 8308454..8308609 1..156 100 -> Plus

LD06016.pep Sequence

Translation from 90 to 1283

> LD06016.pep
MSDVLKSSQERSRKRRLLLAQTLGLSSVDDLKKALGNAEDINSSRQLNSG
GQREEEDGGASSSKKTPNEIIYRDSSTFLKGTQSSNPHNDYCQHFVDTGQ
RPQNFIRDVGLADRFEEYPKLRELIKLKDKLIQDTASAPMYLKADLKSLD
VKTLGAKFDVILIEPPLEEYARAAPSVATVGGAPRVFWNWDDILNLDVGE
IAAHRSFVFLWCGSSEGLDMGRNCLKKWGFRRCEDICWIRTNINKPGHSK
QLEPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGS
FEKPIEIFHIIEHFCLGRRRLHLFGRDSSIRPGWLTVGPELTNSNFNSEL
YQTYFAEAPATGCTSRIELLRPKSPPPNSKVLRGRGRGFPRGRGRPR*

LD06016.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14632-PA 397 GF14632-PA 1..382 1..382 1875 96.1 Plus
Dana\GF17033-PA 608 GF17033-PA 385..594 135..365 258 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10531-PA 397 GG10531-PA 1..397 1..397 2106 99 Plus
Dere\GG11246-PA 608 GG11246-PA 385..594 135..365 259 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11588-PA 401 GH11588-PA 1..386 1..382 1870 94 Plus
Dgri\GH18483-PA 611 GH18483-PA 391..600 135..365 259 29.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 397 CG7818-PA 1..397 1..397 2097 100 Plus
Ime4-PA 608 CG5933-PA 385..594 135..365 253 29.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17157-PA 405 GI17157-PA 1..405 1..397 1885 90.4 Plus
Dmoj\GI24144-PA 617 GI24144-PA 397..606 135..365 260 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18735-PA 397 GL18735-PA 1..382 1..382 1901 94.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20607-PA 397 GA20607-PA 1..382 1..382 1901 94.8 Plus
Dpse\GA19241-PA 612 GA19241-PA 387..596 135..365 258 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16880-PA 397 GM16880-PA 1..397 1..397 2111 99.5 Plus
Dsec\GM26549-PA 584 GM26549-PA 365..570 139..365 258 29.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23521-PA 397 GD23521-PA 1..397 1..397 2114 99.7 Plus
Dsim\GD21055-PA 154 GD21055-PA 1..140 218..365 210 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17661-PA 406 GJ17661-PA 1..391 1..382 1832 91.8 Plus
Dvir\GJ24659-PA 614 GJ24659-PA 394..603 135..365 260 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23852-PA 402 GK23852-PA 1..383 1..382 1874 93.7 Plus
Dwil\GK14179-PA 608 GK14179-PA 384..593 135..365 258 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18751-PA 397 GE18751-PA 1..397 1..397 2103 99.2 Plus
Dyak\GE23438-PA 608 GE23438-PA 385..594 135..365 259 29.7 Plus

LD06016.hyp Sequence

Translation from 90 to 1283

> LD06016.hyp
MSDVLKSSQERSRKRRLLLAQTLGLSSVDDLKKALGNAEDINSSRQLNSG
GQREEEDGGASSSKKTPNEIIYRDSSTFLKGTQSSNPHNDYCQHFVDTGQ
RPQNFIRDVGLADRFEEYPKLRELIKLKDKLIQDTASAPMYLKADLKSLD
VKTLGAKFDVILIEPPLEEYARAAPSVATVGGAPRVFWNWDDILNLDVGE
IAAHRSFVFLWCGSSEGLDMGRNCLKKWGFRRCEDICWIRTNINKPGHSK
QLEPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGS
FEKPIEIFHIIEHFCLGRRRLHLFGRDSSIRPGWLTVGPELTNSNFNSEL
YQTYFAEAPATGCTSRIELLRPKSPPPNSKVLRGRGRGFPRGRGRPR*

LD06016.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 397 CG7818-PA 1..397 1..397 2097 100 Plus
Ime4-PA 608 CG5933-PA 385..594 135..365 253 29.3 Plus