Clone LD08529 Report

Search the DGRC for LD08529

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:85
Well:29
Vector:pBS SK-
Associated Gene/TranscriptSry-beta-RA
Protein status:LD08529.pep: gold
Preliminary Size:1453
Sequenced Size:1265

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7938 2001-01-01 Release 2 assignment
CG7938 2002-05-30 Blastp of sequenced clone
CG7938 2003-01-01 Sim4 clustering to Release 3
Sry-beta 2008-04-29 Release 5.5 accounting
Sry-beta 2008-08-15 Release 5.9 accounting
Sry-beta 2008-12-18 5.12 accounting

Clone Sequence Records

LD08529.complete Sequence

1265 bp (1265 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118322

> LD08529.complete
CACAGCTCTGGCGTTCACAACAAAATATACACAAATTAAATTGTTTAAGC
CGAATTTTCGATTGGATTCCACGGCGACTAGATGAGCTCCACGCGTCCGT
TTTGCTTCGTTTGCGGCAAGGAGAAGTCCGTGGGGGTGTTCCAGCTGATA
GAAGGCTGCATTGTGCCAGGAACCTTTAAGCCCATCAAGGATATACTGAA
ATACTTCGAGAAGATCATAAACCAGCGGCTGGAGCTCCTGCCCAACTCGG
CCGCCTGCCGGGACTGCCTGGAGTACCTCTTCAACTACGACAGGCTGGTG
AGGAATCTCAGCCAAGTGCAGCGCCAGATTGCGGACGCACTGCTCGGCTG
CAGGCAGGTGGAGGGCAAGGCGGAGACCAAGCAACAGGCGGCAAAGAGGG
CCCGCGTCCAGGTGCCGGCCTTCAAGATCGTCCAGGCCACCGCCCTCAAG
GAGCCCGAAAGGCAGCCGGGCGAGGAGGATGAGTGCGAGGAATTCATGAA
GGAGGAGATGCTGGACGAGGAGTTCCAGTTCAGCGAGCCGGACGACAGCA
TGCCGTCGTCGGAGGAGGAGTTCTTCACCGAGACCACCGAGATACCCTGC
CATATCTGCGGCGAGATGTTTTCCAGCCAGGAGGTGCTCGAGCGGCACAT
CAAGGCGGACACCTGCCAGAAGAGCGAGCAGGCCACCTGCAACGTGTGTG
GCTTGAAAGTGAAGGACGACGAGGTACTCGATCTGCATATGAACTTGCAC
GAGGGCAAAACAGAACTTGAATGCCGCTACTGCGACAAAAAGTTCTCGCA
CAAGCGGAACGTCCTGCGCCACATGGAGGTGCACTGGGACAAGAAGAAGT
ACCAGTGCGACAAGTGCGGCGAACGCTTCTCGCTCTCCTGGCTGATGTAC
AACCATCTGATGCGCCACGACGCCGAGGAGAACGCCCTGATCTGCGAGGT
GTGCCACCAGCAGTTCAAGACCAAGCGCACCTACAAGCACCACTTGCGCA
CCCACCAGACGGACCGGCCGCGCTACCCCTGCCCCGACTGCGAGAAATCG
TTCGTGGACAAGTACACCCTGAAGGTGCACAAGCGGGTCCACCAGCCGGT
CGAGAAGCCAGAGTCGGCGGAGGCCAAGGAAGCCACCGTCACGTTCTTTT
AGGGTAGTCCTTTGCTAGATTAATCTAAGAAGCCCAGCTCATGGGTGCAT
TAGCGCGCGTATGTATCATAAAATTAAATCTAAACAATTATTGACGGAAA
AAAAAAAAAAAAAAA

LD08529.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta.c 5242 Sry-beta.c 71..1320 1..1250 6250 100 Plus
Sry-beta-RA 1459 Sry-beta-RA 71..1320 1..1250 6250 100 Plus
Sry-beta.d 1673 Sry-beta.d 71..1320 1..1250 6250 100 Plus
Sry-beta.c 5242 Sry-beta.c 4482..4619 733..870 300 81.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25862352..25863446 153..1247 5430 99.7 Plus
chr3R 27901430 chr3R 25862147..25862301 1..155 775 100 Plus
chr3R 27901430 chr3R 25866611..25866748 733..870 300 81.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 1071 CG7938-PB 1..1071 82..1152 5355 100 Plus
Sry-beta-RA 1071 CG7938-PA 1..1071 82..1152 5355 100 Plus
Sry-delta-RA 1302 CG17958-PA 718..855 733..870 300 81.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 3300 CG7938-RB 14..1260 1..1247 6235 100 Plus
Sry-beta-RA 1260 CG7938-RA 14..1260 1..1247 6235 100 Plus
Sry-alpha-RB 3353 CG17957-RB 219..1313 153..1247 5475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-PB 356 CG7938-PB 1..356 82..1149 1689 100 Plus
Sry-beta-PA 356 CG7938-PA 1..356 82..1149 1689 100 Plus
Sry-delta-PA 433 CG17958-PA 196..360 598..1095 513 51.2 Plus
CG7928-PA 457 CG7928-PA 257..420 592..1095 274 33.9 Plus
CG15269-PA 587 CG15269-PA 327..489 598..1092 264 32.1 Plus
CG7928-PA 457 CG7928-PA 314..450 598..999 164 28.8 Plus
CG7928-PA 457 CG7928-PA 252..367 751..1107 160 32 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30039937..30041034 153..1250 5490 100 Plus
3R 32079331 3R 30039732..30039886 1..155 775 100 Plus
3R 32079331 3R 30044196..30044333 733..870 300 81.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29780768..29781865 153..1250 5490 100 Plus
3R 31820162 3R 29780563..29780717 1..155 775 100 Plus
3R 31820162 3R 29785027..29785164 733..870 300 81.1 Plus
Blast to na_te.dros performed 2014-11-27 13:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 127..162 552..587 117 80.6 Plus

LD08529.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 14:00:30 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25862354..25863446 155..1247 99   Plus
chr3R 25862147..25862300 1..154 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:41:18 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 82..1152 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:00 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 82..1152 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:48 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 82..1152 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:38 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 82..1152 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:30 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 82..1152 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:09:19 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1247 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:00 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1247 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:48 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 14..1260 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:38 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1247 1..1247 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:30 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 14..1260 1..1247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:00:30 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30039939..30041031 155..1247 100   Plus
3R 30039732..30039885 1..154 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:48 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25865661..25866753 155..1247 100   Plus
arm_3R 25865454..25865607 1..154 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:10 Download gff for LD08529.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29780770..29781862 155..1247 100   Plus
3R 29780563..29780716 1..154 100 -> Plus

LD08529.pep Sequence

Translation from 81 to 1151

> LD08529.pep
MSSTRPFCFVCGKEKSVGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRL
ELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETK
QQAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQF
SEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQ
ATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEV
HWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRT
YKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE
ATVTFF*

LD08529.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22992-PA 357 GF22992-PA 1..357 1..346 1459 78 Plus
Dana\GF22993-PA 430 GF22993-PA 193..357 173..338 494 52.4 Plus
Dana\GF14340-PA 593 GF14340-PA 334..496 173..337 248 32.7 Plus
Dana\GF13861-PA 559 GF13861-PA 341..521 159..338 240 29.7 Plus
Dana\GF23243-PA 438 GF23243-PA 235..401 168..338 238 33.3 Plus
Dana\GF14340-PA 593 GF14340-PA 297..472 158..341 222 30.6 Plus
Dana\GF13861-PA 559 GF13861-PA 331..497 174..343 203 30 Plus
Dana\GF14340-PA 593 GF14340-PA 420..522 173..275 151 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11722-PA 356 GG11722-PA 1..356 1..356 1791 96.6 Plus
Dere\GG11724-PA 431 GG11724-PA 30..358 28..338 534 35.6 Plus
Dere\GG25148-PA 606 GG25148-PA 344..506 173..337 248 32.1 Plus
Dere\GG11973-PA 450 GG11973-PA 207..413 136..338 241 30.7 Plus
Dere\GG21465-PA 560 GG21465-PA 338..522 155..338 239 29.1 Plus
Dere\GG25148-PA 606 GG25148-PA 317..482 173..341 215 30.4 Plus
Dere\GG25148-PA 606 GG25148-PA 430..532 173..275 155 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19170-PA 347 GH19170-PA 1..345 1..346 1326 70.3 Plus
Dgri\GH19172-PA 419 GH19172-PA 4..344 8..337 488 35 Plus
Dgri\GH10919-PA 579 GH10919-PA 316..478 173..337 247 32.7 Plus
Dgri\GH18403-PA 454 GH18403-PA 235..417 147..338 236 31.2 Plus
Dgri\GH10979-PA 578 GH10979-PA 360..540 159..338 236 29.7 Plus
Dgri\GH10919-PA 579 GH10919-PA 402..504 173..275 150 32.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-PB 356 CG7938-PB 1..356 1..356 1928 100 Plus
Sry-beta-PA 356 CG7938-PA 1..356 1..356 1928 100 Plus
Sry-delta-PA 433 CG17958-PA 30..360 28..338 597 35.9 Plus
CG7928-PA 457 CG7928-PA 195..420 119..338 295 30.3 Plus
Opbp-PA 562 CG30443-PA 188..405 136..337 273 27.5 Plus
CG7928-PA 457 CG7928-PA 70..367 44..342 173 25.6 Plus
CG7928-PA 457 CG7928-PA 311..450 170..306 165 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24206-PA 346 GI24206-PA 1..343 1..351 1302 70.7 Plus
Dmoj\GI24208-PA 411 GI24208-PA 4..338 8..338 522 35.7 Plus
Dmoj\GI13302-PA 606 GI13302-PA 338..500 173..337 246 32.7 Plus
Dmoj\GI23393-PA 449 GI23393-PA 246..412 168..338 241 33.3 Plus
Dmoj\GI18627-PA 612 GI18627-PA 254..453 155..337 240 29.3 Plus
Dmoj\GI13302-PA 606 GI13302-PA 311..476 173..341 221 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14020-PA 393 GL14020-PA 1..239 1..226 722 63.7 Plus
Dper\GL14023-PA 421 GL14023-PA 4..348 8..338 525 36.4 Plus
Dper\GL14020-PA 393 GL14020-PA 328..393 278..343 326 90.9 Plus
Dper\GL26031-PA 597 GL26031-PA 343..505 173..337 250 32.7 Plus
Dper\GL26169-PA 557 GL26169-PA 339..519 159..338 238 29.7 Plus
Dper\GL13484-PA 436 GL13484-PA 199..399 136..338 232 30.7 Plus
Dper\GL26031-PA 597 GL26031-PA 316..481 173..341 221 31 Plus
Dper\GL26169-PA 557 GL26169-PA 357..495 202..343 197 33.1 Plus
Dper\GL26169-PA 557 GL26169-PA 386..532 173..319 191 30.7 Plus
Dper\GL26031-PA 597 GL26031-PA 429..531 173..275 153 32.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26935-PA 356 GA26935-PA 1..356 1..343 1351 74.2 Plus
Dpse\GA14741-PA 419 GA14741-PA 4..346 8..338 525 36.5 Plus
Dpse\GA13615-PA 599 GA13615-PA 345..507 173..337 250 32.7 Plus
Dpse\GA14887-PA 557 GA14887-PA 339..519 159..338 238 29.7 Plus
Dpse\GA20696-PA 436 GA20696-PA 199..399 136..338 232 30.7 Plus
Dpse\GA13615-PA 599 GA13615-PA 318..483 173..341 221 31 Plus
Dpse\GA14887-PA 557 GA14887-PA 357..495 202..343 197 33.1 Plus
Dpse\GA14887-PA 557 GA14887-PA 386..532 173..319 191 30.7 Plus
Dpse\GA13615-PA 599 GA13615-PA 431..533 173..275 153 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12853-PA 356 GM12853-PA 1..356 1..356 1868 98 Plus
Dsec\GM12855-PA 434 GM12855-PA 30..361 28..338 533 35.6 Plus
Dsec\GM15938-PA 643 GM15938-PA 383..545 173..337 247 32.1 Plus
Dsec\GM16114-PA 561 GM16114-PA 339..523 155..338 240 29.1 Plus
Dsec\GM23958-PA 377 GM23958-PA 223..359 168..307 221 29.3 Plus
Dsec\GM15938-PA 643 GM15938-PA 356..521 173..341 215 30.4 Plus
Dsec\GM16114-PA 561 GM16114-PA 345..499 186..343 198 31 Plus
Dsec\GM15938-PA 643 GM15938-PA 469..571 173..275 152 32.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Sry-beta-PA 356 GD21495-PA 1..356 1..356 1874 98.3 Plus
Dsim\Sry-delta-PA 300 GD21498-PA 63..227 173..338 474 51.2 Plus
Dsim\GD23994-PA 592 GD23994-PA 332..494 173..337 247 32.1 Plus
Dsim\GD17432-PA 450 GD17432-PA 191..413 116..338 244 31.7 Plus
Dsim\GD18768-PA 377 GD18768-PA 223..359 168..307 221 29.3 Plus
Dsim\GD23994-PA 592 GD23994-PA 305..470 173..341 216 30.4 Plus
Dsim\GD23994-PA 592 GD23994-PA 418..520 173..275 152 32.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Sry-beta-PA 346 GJ10775-PA 1..336 1..346 1341 73.4 Plus
Dvir\GJ10777-PA 412 GJ10777-PA 4..338 8..337 527 34.8 Plus
Dvir\GJ11932-PA 596 GJ11932-PA 336..498 173..337 245 32.7 Plus
Dvir\GJ10388-PA 435 GJ10388-PA 199..398 131..338 243 31.6 Plus
Dvir\GJ15143-PA 584 GJ15143-PA 366..546 159..338 237 29.7 Plus
Dvir\GJ11932-PA 596 GJ11932-PA 309..474 173..341 220 31 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13865-PA 402 GK13865-PA 1..383 1..342 1341 70.2 Plus
Dwil\GK13867-PA 427 GK13867-PA 4..374 8..354 526 34.5 Plus
Dwil\GK13423-PA 276 GK13423-PA 139..273 203..337 412 53.3 Plus
Dwil\GK18315-PA 593 GK18315-PA 340..502 173..337 247 32.7 Plus
Dwil\GK15349-PA 566 GK15349-PA 294..528 116..338 247 26.8 Plus
Dwil\GK18315-PA 593 GK18315-PA 313..478 173..341 221 31 Plus
Dwil\GK18315-PA 593 GK18315-PA 426..528 173..275 150 32.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10851-PA 356 GE10851-PA 1..356 1..356 1814 97.8 Plus
Dyak\GE10853-PA 433 GE10853-PA 4..360 8..338 525 33.4 Plus
Dyak\GE20880-PA 596 GE20880-PA 335..497 173..337 246 32.1 Plus
Dyak\GE23423-PA 453 GE23423-PA 210..416 136..338 241 30.7 Plus
Dyak\GE12967-PA 561 GE12967-PA 339..523 155..338 241 29.1 Plus
Dyak\GE20880-PA 596 GE20880-PA 308..473 173..341 215 30.4 Plus
Dyak\GE20880-PA 596 GE20880-PA 421..523 173..275 152 32.4 Plus

LD08529.hyp Sequence

Translation from 81 to 1151

> LD08529.hyp
MSSTRPFCFVCGKEKSVGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRL
ELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETK
QQAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQF
SEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQ
ATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEV
HWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRT
YKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE
ATVTFF*

LD08529.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-PB 356 CG7938-PB 1..356 1..356 1928 100 Plus
Sry-beta-PA 356 CG7938-PA 1..356 1..356 1928 100 Plus
Sry-delta-PA 433 CG17958-PA 30..360 28..338 597 35.9 Plus
CG7928-PA 457 CG7928-PA 195..420 119..338 295 30.3 Plus
Opbp-PA 562 CG30443-PA 188..405 136..337 273 27.5 Plus
CG7928-PA 457 CG7928-PA 70..367 44..342 173 25.6 Plus
CG7928-PA 457 CG7928-PA 311..450 170..306 165 28.2 Plus