Clone LD09689 Report

Search the DGRC for LD09689

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:96
Well:89
Vector:pBS SK-
Associated Gene/TranscriptAdf1-RA
Protein status:LD09689.pep: gold
Preliminary Size:1929
Sequenced Size:1788

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15845 2001-01-01 Release 2 assignment
CG15845 2001-11-09 Blastp of sequenced clone
CG15845 2003-01-01 Sim4 clustering to Release 3
Adf1 2008-04-29 Release 5.5 accounting
Adf1 2008-08-15 Release 5.9 accounting
Adf1 2008-12-18 5.12 accounting

Clone Sequence Records

LD09689.complete Sequence

1788 bp (1788 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069387

> LD09689.complete
GACGTACCGTTACCGTTGGCAGAGACGCGACTGAGAAATAAAATTAAAAC
GTCGACGTTCCTTCCTCGTAGAAGAAACCAATCAAAATAAAAACAAACAG
AGCGTGCGTTCGCGCCAAATACTTAACAACAATTAGCAAACGTAAGAAGC
AAAGTGAGTGTCGTCGGCTGCGGGAGCCCGTGTGCCCAGTTTGGAACTGG
GATCCGACCCAGTCCACGTCCGTCTCGTCCCCGCTAAATTTGTAACTCTT
GTTTCCCCGTCTTGTCCCCTCAGTGCATACCCTCACGGCGGCCATTGAGA
TGGACAAGCTGGATGCCAATCTTGAGCAGCAGTTTGATCTCAATCTCATC
GAGGCTGTCAAGCTGAACCCAGTGATATACGACAGGTCGCACTACAATTA
CAAGCACTTTGTGCGCAAGGCCCAGACCTGGAAACAAATCGCCGAAACGC
TCGGTGTGCCTGAACAAAAATGTACGAAGCGCTGGAAGAGTCTGCGCGAC
AAGTTCGCCCGCGAGATGAAACTATGTCAGGAATCGCGCTGGCGTTACTT
CAAGCAGATGCAATTCCTGGTTGACTCCATCCGCCAGTATCGAGAGTCGC
TGCTCGGCAAGTGCGCCAATGGGAGTCAAAGCGCCAACCAGGTGGCCGAT
CCGTCGCAGCAGCAGCAGGCGCAGCAACAGACCGTCGTGGATATATTTGC
ACAGCCCTTCAACGGCAGCGCCACAACCTCGGCCCAGGCACTGACCCATC
CGCATGAAATTACTGTCACCAGCGATGCACAGCTGGCCACTGCCGTGGGC
AAGGACCAAAAGCCATACTTCTACGAGCCGCCGCTCAAGCGAGAGCGCAG
TGAGGAGGAGCACAGCGACAACATGCTCAACACCATCAAGATTTTCCAAA
ACAACGTCTCGCAGGCGGTCAGCGCCGAGGACCAGTCGTTCGGCATGGTA
GTCACGGACATGCTCAACACGCTGGGCGTGCGACAAAAGGCAGAGGCGAA
GGTGCACATCATCAAGTATCTGACGGACATGCAGCTTCTGGCACAGCACA
ACAAGTACTAACTGTCGGGCGGCTGTCATCGGCAGCTGCTGCAGCTGCTC
CAACTGGAGAGCGTTCTGCCCTGAGATCAAACGAGAACAGACCCACGGCT
ACCCACATCCACATCTACACGGGTTTGGGGGTCCTGTGCGGTCATTTTCT
ACAGTTCATAGGTCTTAAAGTCAAACTACAGAATAACATTAGACGTAACA
TCCCACAGCGTAAACCATAACGCGTAATGATACTTCCCCACGCCCATGTA
GACAAACATATATATTTATATGCTTAGTTGACCCCATGATCGGTGATTTA
ATTCGCGCCCAGTTCTCAGCTCTGTACAAAAAATGCGATTGAAAATAGCG
ATTCTAGAATTATGAGTAGCTTGTTAAAAGACCGTGGAAACACTTTATAT
GCAGCGTATTGTAAATTTTGACTACGATTTAGTTGTAATTTGCCATCGGG
TCTTAGCTCTAAAACTAAGTATACACGTAAAAGTTATTTTAATTTTATAA
GTTCTGTTGTAATATGCCGAAAACGCTTGAAAGACACTTTGAAATGCTTA
ATTAAGTGTGACAAAGGGAAACATAAAACACCTTTTTCATAGTGATCGCA
TATTACACACTTTACATGGATACGAGTAAAATCGAAATAGTTGCCGGCAA
CGCCAGTTGCTAAACATTTTTAATGATTAATTGTGCAATTATTTGGTATT
AAATGAAACATTTGAAAGTAAAAAAAAAAAAAAAAAAA

LD09689.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RB 1961 Adf1-RB 86..1856 1..1771 8855 100 Plus
Adf1-RC 1841 Adf1-RC 239..1736 274..1771 7490 100 Plus
Adf1-RA 1829 Adf1-RA 227..1724 274..1771 7490 100 Plus
Adf1-RC 1841 Adf1-RC 86..238 1..153 765 100 Plus
Adf1-RA 1829 Adf1-RA 86..226 1..141 705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2554264..2555277 756..1769 5070 100 Plus
chr2R 21145070 chr2R 2549489..2549950 1..462 2310 100 Plus
chr2R 21145070 chr2R 2553911..2554205 462..756 1475 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 825 CG15845-PE 1..825 300..1124 4125 100 Plus
Adf1-RC 789 CG15845-PC 2..789 274..1061 3940 100 Plus
Adf1-RB 762 CG15845-PB 1..762 300..1061 3810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RB 1795 CG15845-RB 27..1795 1..1769 8845 100 Plus
Adf1-RE 1668 CG15845-RE 173..1668 274..1769 7480 100 Plus
Adf1-RC 1675 CG15845-RC 180..1675 274..1769 7480 100 Plus
Adf1-RE 1668 CG15845-RE 32..172 1..141 705 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PE 274 CG15845-PE 1..274 300..1121 1318 99.6 Plus
Adf1-PC 262 CG15845-PC 1..262 273..1058 1304 99.6 Plus
Adf1-PB 253 CG15845-PB 1..253 300..1058 1264 100 Plus
Adf1-PA 253 CG15845-PA 1..253 300..1058 1264 100 Plus
CG10949-PB 459 CG10949-PB 129..221 297..569 171 41.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6668087 756..1771 5080 100 Plus
2R 25286936 2R 6662296..6662757 1..462 2310 100 Plus
2R 25286936 2R 6666719..6667013 462..756 1475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6668271..6669286 756..1771 5080 100 Plus
2R 25260384 2R 6663495..6663956 1..462 2310 100 Plus
2R 25260384 2R 6667918..6668212 462..756 1475 100 Plus
Blast to na_te.dros performed 2014-11-27 03:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 6929..6987 43..101 115 66.1 Plus

LD09689.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:41:11 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2554265..2555277 757..1769 100   Plus
chr2R 2553912..2554205 463..756 100 -> Plus
chr2R 2549489..2549950 1..462 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:48 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 2..789 274..1061 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:29:58 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 2..789 274..1061 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:15 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RE 1..825 300..1124 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:57:33 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 2..789 274..1061 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:41:11 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RE 1..825 300..1124 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:07:42 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 28..1796 1..1769 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:29:57 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 28..1796 1..1769 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:15 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 27..1795 1..1769 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:57:33 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 28..1796 1..1769 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:41:11 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 27..1795 1..1769 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:41:11 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6668085 757..1769 100   Plus
2R 6666720..6667013 463..756 100 -> Plus
2R 6662296..6662757 1..462 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:15 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2555590 757..1769 100   Plus
arm_2R 2554225..2554518 463..756 100 -> Plus
arm_2R 2549801..2550262 1..462 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:33:53 Download gff for LD09689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668272..6669284 757..1769 100   Plus
2R 6667919..6668212 463..756 100 -> Plus
2R 6663495..6663956 1..462 100 -> Plus

LD09689.pep Sequence

Translation from 299 to 1060

> LD09689.pep
MDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAET
LGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRES
LLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTH
PHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQ
NNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQH
NKY*

LD09689.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11060-PA 535 GF11060-PA 283..535 1..253 1376 98.8 Plus
Dana\GF15373-PA 460 GF15373-PA 141..255 16..121 182 35.6 Plus
Dana\GF10717-PA 679 GF10717-PA 302..398 7..96 153 33 Plus
Dana\GF15373-PA 460 GF15373-PA 3..102 13..103 148 34 Plus
Dana\GF17699-PA 337 GF17699-PA 28..121 11..98 146 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23211-PA 253 GG23211-PA 1..253 1..253 1366 99.6 Plus
Dere\GG21572-PA 459 GG21572-PA 141..391 16..236 180 25.6 Plus
Dere\GG13380-PA 678 GG13380-PA 39..139 13..108 153 33.3 Plus
Dere\GG21572-PA 459 GG21572-PA 3..92 13..96 152 34.4 Plus
Dere\GG13380-PA 678 GG13380-PA 306..402 7..96 150 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21743-PA 253 GH21743-PA 1..253 1..253 1296 96.8 Plus
Dgri\GH14617-PA 770 GH14617-PA 402..498 7..96 166 35.1 Plus
Dgri\GH11654-PA 502 GH11654-PA 142..236 16..107 164 40.8 Plus
Dgri\GH11654-PA 502 GH11654-PA 3..95 13..102 151 34.4 Plus
Dgri\GH20726-PA 334 GH20726-PA 12..95 13..90 150 32.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PB 253 CG15845-PB 1..253 1..253 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 1..253 1311 100 Plus
Adf1-PC 262 CG15845-PC 10..262 1..253 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 1..253 1311 100 Plus
CG10949-PB 459 CG10949-PB 131..391 2..236 170 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19291-PA 253 GI19291-PA 1..253 1..253 1299 97.2 Plus
Dmoj\GI17956-PA 461 GI17956-PA 142..253 16..128 172 37.8 Plus
Dmoj\GI13504-PA 728 GI13504-PA 349..454 7..107 164 34.3 Plus
Dmoj\GI20810-PA 335 GI20810-PA 12..95 13..90 148 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11108-PA 250 GL11108-PA 1..250 1..253 1246 93.7 Plus
Dper\GL26413-PA 448 GL26413-PA 140..254 16..121 155 33 Plus
Dper\GL20873-PA 737 GL20873-PA 306..402 7..96 150 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13983-PA 250 GA13983-PA 1..250 1..253 1246 93.7 Plus
Dpse\GA10661-PA 448 GA10661-PA 140..254 16..121 156 33 Plus
Dpse\GA21303-PA 697 GA21303-PA 320..416 7..96 151 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20885-PA 253 GM20885-PA 1..253 1..253 1366 99.6 Plus
Dsec\GM23328-PA 459 GM23328-PA 141..391 16..236 187 26.8 Plus
Dsec\GM10256-PA 336 GM10256-PA 28..121 11..98 153 36.2 Plus
Dsec\GM16842-PA 683 GM16842-PA 35..135 13..108 152 32.4 Plus
Dsec\GM16842-PA 683 GM16842-PA 302..398 7..96 151 32 Plus
Dsec\GM23328-PA 459 GM23328-PA 3..102 13..103 149 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10415-PA 253 GD10415-PA 1..253 1..253 1366 99.6 Plus
Dsim\GD21703-PA 459 GD21703-PA 141..391 16..236 183 26.8 Plus
Dsim\GD21228-PA 336 GD21228-PA 28..121 11..98 153 36.2 Plus
Dsim\GD12257-PA 682 GD12257-PA 302..398 7..96 151 32 Plus
Dsim\GD12257-PA 682 GD12257-PA 35..135 13..108 151 32.4 Plus
Dsim\GD21703-PA 459 GD21703-PA 3..102 13..103 150 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22167-PA 253 GJ22167-PA 1..253 1..253 1348 98 Plus
Dvir\GJ11865-PA 706 GJ11865-PA 338..498 7..158 164 27 Plus
Dvir\GJ20543-PA 330 GJ20543-PA 12..95 13..90 151 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23084-PA 253 GK23084-PA 1..253 1..253 1248 96.9 Plus
Dwil\GK18122-PA 430 GK18122-PA 149..229 16..90 165 43.2 Plus
Dwil\GK25760-PA 693 GK25760-PA 305..403 7..96 149 32.3 Plus
Dwil\GK18122-PA 430 GK18122-PA 3..88 13..92 147 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19065-PA 253 GE19065-PA 1..253 1..253 1366 99.6 Plus
Dyak\GE12593-PA 459 GE12593-PA 141..321 16..178 179 30.2 Plus
Dyak\GE22473-PA 679 GE22473-PA 311..407 7..96 150 32 Plus
Dyak\GE22475-PA 745 GE22475-PA 378..474 7..96 148 32 Plus

LD09689.hyp Sequence

Translation from 299 to 1060

> LD09689.hyp
MDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAET
LGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRES
LLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTH
PHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQ
NNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQH
NKY*

LD09689.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PB 253 CG15845-PB 1..253 1..253 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 1..253 1311 100 Plus
Adf1-PC 262 CG15845-PC 10..262 1..253 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 1..253 1311 100 Plus
CG10949-PB 459 CG10949-PB 131..391 2..236 170 25.6 Plus