Clone LD09801 Report

Search the DGRC for LD09801

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:98
Well:1
Vector:pBS SK-
Associated Gene/Transcriptckn-RB
Protein status:LD09801.pep: gold
Preliminary Size:1215
Sequenced Size:4357

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12424 2001-01-01 Release 2 assignment
CG12424 2003-07-26 Blastp of sequenced clone
CG12424 2008-04-29 Release 5.5 accounting
CG12424 2008-08-15 Release 5.9 accounting
CG12424 2008-12-18 5.12 accounting

Clone Sequence Records

LD09801.complete Sequence

4357 bp (4357 high quality bases) assembled on 2003-07-26

GenBank Submission: BT010077

> LD09801.complete
CGCTGTTCGGACGTTTGTAGCGGAAACCCGTTCTTTTGTCGTTAGATTCA
AAAACGAAATATATCACAAGTACGGATATCACAACAAAGTAAAGTGATTA
TAATTACAAAGTAAGAAAGCAGTGCTTAATATATCTGAGAAAATAAAAAA
AATAAATAAAACTCAACAAATTGCCACAAAAGAAAATGGCGGCTCAGCAA
ATAAAAAAGAGCACTCGCGACCACAACAACTGAGCAAGAAATTCAGCTTA
AAAGAAACCAACAAAAAAAAAAGCGTCAACATTTTCGTCTGCCTGAAATT
AATCTGGTTTTTATGTTTTACTCGCGCGTCGTAGACATAAAATAAAGACA
ACAAACAGTGAGTTTTGGTGCGAGTGGATGTGTCTGCGTGCGTTTGATGC
CGTTTGTTAGTCTCTTGTTTTTGTGGAAAAAACCATAAAAAACGTGAAAT
TCATTAAGCTACAAAAGCAACAATTACGAGCGTTTTACATTGTTTACATT
TTGTGTGCCAGCTTTCGTTACGCTTGTGATTTATGTGATTTGTCGAACGG
TAAGAGGAGGAGCGGAGAGAACTTAGCCAAAAGCCTGGAAAATAGTAATA
TTATCTGCTAACGAGTCGGCGAAGATACGGCCCCGGCGGCCAGTAGAGGC
GCATCATAATCATGCATCGTTCGCTGAAGCCGCATGCATCCACCGCACAG
GCTAAGAAGGTGCAACCGCCAACGATACCAGGCGACTCGCCGCAGGATTT
GCATCTCTATCAGCAGCCGCAGCAGCTTCACCACCACCACCATCAACACC
CAAACCATCATCATCCGCACCACCAGCCATCGATACCGCTCTATCGGCTA
AGCGGACCACTGCGCCATCATCAAAACCACCAGGCGGACGATGGGATCAG
CATGAGCGGCAGCAGCATCGTTTCGTCGCCCTCGCTGGAGGAGGGTGGCT
TCAATTTGCCGCGGGAGACGAGTGTGGCCCTGCGTCTTAAGGATGAAGTG
GGTGGCACTTCAACGGCAGCCCCAACCACTGGCGGCCCAGGAGGAGGTGG
AGCGACGGTGGTGGGAGCACCACCACCCGGTGCCGGAAAGCCCGGCGTAG
CCATGGTTCCACCGCCACCCGTTTTCTGTGCCACTTTGCGCGAACCGCTG
ACCCACAAAGCGGCCGTCTACTACCACCAACAGCTGGCCCTGCAGGAGGA
TCAGGGCATCGATCTAACCCAATCGCCTGGCCGAGACTCGCCGGGCTCGT
CGTCGGGCTCGGCGGGCTCTGGATCTCGTCACAGCACCGCCAGCTTGGAC
TCGGGTCGGGCCTCCTCCTACCTGACGGGCGTGTCCTCGTCGGGCGCCTC
GATTCGTGCTCCGCTCTCCTCGCCGCGCTGCAGTTCCGTCAGCTCGTGCT
CCATTGGCAGTGTGGATCGGCAGCGCAACGATGAGCTCATCATCGACTGG
CTGCTCGAGATGAAGCACGAGGAGTACGCGCAGCTGTTCATCGCCGCGGG
CTATGATCTGCCCACCATTGCGCGCATGACGCCGGAGGATCTCACCGCCA
TTGGCATTAAGAATCCGCATCATCGGGAGCGGATCAAGCAGCGGATCGAC
AAGCTGCAGGTGCTCGACAATTTGCCGCATTTCGTGCCGGGATCCATAGA
GGAATGGCTGCAGCTGCTGCGTCTGGAGGAGTATATACAGCCCCTGCTGG
AGCAGAACTATAAGACGGTGCGCGACGTAACCCAAGTGACTTGGGAGGAT
CTCGAGGACATTGGCATTGTCAAGCTGGGCCACCAAAAGAAAATTCTGCT
GGCCATCAAGCGTGTGAAGGACATAATTAGCGGAAAGTGGAACCCAGGCG
GCGCCAATGCCTACCAACAGCAGGAGTACCAGCGGAAGCCCTGGCAATTC
AATGTGCCCATACCCAGTACGCCATCCTATGTGCCAACCACCCGCGTCTC
GTGGGACGACACGAAAATCTACGCGACCAGCAGTGTCTTGAATTCCACTG
CCCCATCCGGGAGCAGCTGCCTCAATAGCAGCCTTGCCAACGGAGATGCC
TACTACTGCACGGGCAGTAACCATGAGTGCTGCTCGGGCAACGATGTGGT
GCTCATTAAGGTTCGCCAGCCGCGCGGCAAGAGCCTGGAATCTTTGGAGG
ACATCCACGACAACAGCACGCGCAGCCATCTGACCTTCAGCCATTACACA
ACCACGGACTACGGCCACTTTGGGCCGCCGACAACAGCGGCGGCTGCAGC
GGCAATGGCCGCAGCGGCCACACTGCAGCAGCAGCATCATCACCAGCAGC
TGCTCCACCAGCAACAGCAGCAGGCAGCTGCCGCCCGTCTCCTGGGCAAC
AATGCGCCTGGCATTGGATGGCGGCGATCCTACGACGACGGCGACATCAC
ACCCACCAACGATGCCACGAGGGAGCTGCTCTACGAGCAGGAGGGCGGCG
GAACTCTGCCACGCCAGCAGCGTGGCATCCTGCAGCGGGCGGTGTTGAAC
ACCATGCCGCCACTGGAGCACCATCACTACATGAATGCAGCGGCTGCGGC
GGAGTACGGTGCGGCCAGCGGTGTGGAGGGTGGAGCGAATTACATGGGCG
GCAGTCCTTTGACGGGCAAGAAAATAGCTCCTGAGCCACCTAGACGCCAC
TGCAGCATACGCAACTCCCGCACGCTGAGCGGAGAGGGAGTGCCGTCGGG
AGCGGCTGCGCAGGCGCATCAGCAGGCAGCCCAACAGCAGCAGGGCCAGC
ACATGTTCTACGGCCACACGGCGCAGCACTGGCAGCAGCAGCAGCAGCAG
GCGGGTGCAGGTACTGGTCAGCAGCCGATCTACGCCAACTATGCCACCAT
ACAACAGACAACGGCGGAGATACACTGTGAGAAGTATCACGACAGTAAGT
CGACTTCCAGCATCGATTCGATTGACACGATACCATTTGCCAACGAGAAC
ACTGGGACGATAAAACAGCGGCTGCTCAACCGCCAGGAGCTGCAGGGCGG
CGGAGCGGGCAACAACAATGTACCCGGCGGCGGCCATCCCGCACACCTGC
ACTCCTCCAGCTCGAGCTCCAGCTCCTCCTCCACGAACACCATCGCGAAT
ATAGCGCACTCGTTCCATTCGTTGAAATCTTCCAGTTCGCTGCACGATGC
CACATTGGCGCGGAGTGAAAGCATGGGCAGCACAGCCAGCGGTGGAAGTG
CCTTGCACCTGCGTTCACCCACATTGGATATGTCAAATGCCGGTGGATCA
ACGGCGGAGCCTGCAAGTTCGCCAGAAGCAGCCGTACCAACTGTGGCCAT
AAACAACGGCGTTCCGCCCAAAGTTTCGGTGAACGTTCTGAACGACATTG
GCAATATGCTGGCCAATCTCACGGACGAGCTGGACGCCATGCTGGAGGAG
GAGAAGCGAGTGGGCCTAAACATAGACAGTGAATAAATCTCCAATCAAAC
AACAAATCGTAGTGTAGCTGAATTTAGAAGTTGTGGTGTATCTTGTAATG
TTTTATGTACTTCAACTTAGTTAAGTTCAATTTGTTTTTGTATTTCTTAT
TCCAATTGCGTGTGGAGAAGCATTTATATTGGATCGTATTCTGTATCATT
TCGATATGCACACTGTGTAGTAAAAAGCAACTACAACTGAAAAGCTTTGG
ACAAACCATGTATACTTTTGTACTTTTCCTAAACTCTCCTCCCATTCCCG
AAACTATGAGTGTTAACAATACAAAATGAAAATAACCAAGTAAAAGAATG
GTAAATGAAGCGCAACATGCATATATGCAGAACTTGCATAGTTATTATAT
AGCATAAAATATATATAATTCGATATATAAATAAATATTTAAACGAAATC
ATTTATATGGACAAGTATTTAGTGGTTTGATACTATACGACAGAGGAGGA
ATCAACAAATAAACCACACGGCACACTCTTAAACAAACACAATGAAAGTC
AGGCAAGAACTACTATTTAAAGATCCCATTCAGACAATTTCAAATTGTAT
TATTCTAGAATTTTGTACCTTAGTTCTTTGTTCATTTTTTTCAAATCACG
CTGCACAGAAATGTTTCTTTTTGTTATGATTACAACTAAAATCAAACTAT
ATGAAATGAATGTATAATTAAGTGTTATTCCATACAAAGTAAAAAGATGC
ATTATATAAAATATAAATCTTATATTAGCGTTAAATTAAGAAATCAAAAA
TAAAAGAAGGAAACGAATCCATCTTTATAAATTATGTTTAATCGGGCATT
GATGCTGAATAACGTATGAAATTCCGTGGTATACAACTGAATTGCCTTCT
TCTTTATAATTTACATAAATAAAAATCTTTTAGTGAAAAAAAAAAAAAAA
AAAAAAA

LD09801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12424.e 4579 CG12424.e 23..4361 1..4339 21695 100 Plus
CG12424-RC 4364 CG12424-RC 23..4361 1..4339 21695 100 Plus
CG12424.b 3893 CG12424.b 70..3893 512..4335 19120 100 Plus
CG12424.b 3893 CG12424.b 1..69 20..88 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10866108..10867857 2587..4335 8580 99.5 Plus
chr2R 21145070 chr2R 10858989..10860016 613..1640 5095 99.7 Plus
chr2R 21145070 chr2R 10850583..10851195 1..613 2990 99.2 Plus
chr2R 21145070 chr2R 10865500..10865978 2109..2587 2365 99.6 Plus
chr2R 21145070 chr2R 10864956..10865197 1871..2112 1210 100 Plus
chr2R 21145070 chr2R 10864509..10864744 1639..1874 1180 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-RE 2775 CG12424-PE 1..2775 662..3436 13875 100 Plus
ckn-RB 2775 CG12424-PB 1..2775 662..3436 13875 100 Plus
ckn-RC 2775 CG12424-PC 1..2775 662..3436 13875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-RE 4568 CG12424-RE 23..4357 1..4335 21675 100 Plus
ckn-RC 4357 CG12424-RC 23..4357 1..4335 21675 100 Plus
ckn-RB 4039 CG12424-RB 317..4039 613..4335 18615 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-PE 924 CG12424-PE 1..924 662..3433 3089 100 Plus
ckn-PB 924 CG12424-PB 1..924 662..3433 3089 100 Plus
ckn-PC 924 CG12424-PC 1..924 662..3433 3089 100 Plus
ckn-PF 642 CG12424-PF 45..642 1640..3433 2155 100 Plus
ckn-PD 845 CG12424-PD 1..407 662..1882 1341 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14978836..14980588 2587..4339 8765 100 Plus
2R 25286936 2R 14971730..14972757 613..1640 5140 100 Plus
2R 25286936 2R 14963314..14963926 1..613 3065 100 Plus
2R 25286936 2R 14978228..14978706 2109..2587 2395 100 Plus
2R 25286936 2R 14977684..14977925 1871..2112 1210 100 Plus
2R 25286936 2R 14977239..14977474 1639..1874 1180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14980035..14981787 2587..4339 8765 100 Plus
2R 25260384 2R 14972929..14973956 613..1640 5140 100 Plus
2R 25260384 2R 14964513..14965125 1..613 3065 100 Plus
2R 25260384 2R 14979427..14979905 2109..2587 2395 100 Plus
2R 25260384 2R 14978883..14979124 1871..2112 1210 100 Plus
2R 25260384 2R 14978438..14978673 1639..1874 1180 100 Plus
Blast to na_te.dros performed 2014-11-27 10:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 106..279 4241..4068 167 62.1 Minus

LD09801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:53:21 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10866109..10867857 2588..4335 97   Plus
chr2R 10865718..10865978 2327..2587 99 -> Plus
chr2R 10865502..10865622 2111..2231 100 == Plus
chr2R 10864959..10865195 1874..2110 100 -> Plus
chr2R 10864510..10864743 1640..1873 100 -> Plus
chr2R 10859202..10860015 826..1639 99 -> Plus
chr2R 10858989..10859127 613..751 100 == Plus
chr2R 10850583..10851194 1..612 95 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:51:14 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RB 1..2775 662..3436 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:46 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RB 1..2775 662..3436 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:24:59 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 1..2775 662..3436 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:04:18 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RB 1..2775 662..3436 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:21 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 1..2775 662..3436 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:51:13 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RC 1..4335 1..4335 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:46 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RC 1..4335 1..4335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:24:59 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 23..4357 1..4335 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:04:19 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RC 1..4335 1..4335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:21 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 23..4357 1..4335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:53:21 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14978837..14980584 2588..4335 100   Plus
2R 14978230..14978706 2111..2587 100 -> Plus
2R 14977687..14977923 1874..2110 100 -> Plus
2R 14977240..14977473 1640..1873 100 -> Plus
2R 14971730..14972756 613..1639 100 -> Plus
2R 14963314..14963925 1..612 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:24:59 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10866342..10868089 2588..4335 100   Plus
arm_2R 10865735..10866211 2111..2587 100 -> Plus
arm_2R 10865192..10865428 1874..2110 100 -> Plus
arm_2R 10864745..10864978 1640..1873 100 -> Plus
arm_2R 10859235..10860261 613..1639 100 -> Plus
arm_2R 10850819..10851430 1..612 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:42:26 Download gff for LD09801.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14980036..14981783 2588..4335 100   Plus
2R 14979429..14979905 2111..2587 100 -> Plus
2R 14978886..14979122 1874..2110 100 -> Plus
2R 14978439..14978672 1640..1873 100 -> Plus
2R 14972929..14973955 613..1639 100 -> Plus
2R 14964513..14965124 1..612 100 -> Plus

LD09801.pep Sequence

Translation from 661 to 3435

> LD09801.pep
MHRSLKPHASTAQAKKVQPPTIPGDSPQDLHLYQQPQQLHHHHHQHPNHH
HPHHQPSIPLYRLSGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGFNLP
RETSVALRLKDEVGGTSTAAPTTGGPGGGGATVVGAPPPGAGKPGVAMVP
PPPVFCATLREPLTHKAAVYYHQQLALQEDQGIDLTQSPGRDSPGSSSGS
AGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRCSSVSSCSIGS
VDRQRNDELIIDWLLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIK
NPHHRERIKQRIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLLEQNY
KTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDIISGKWNPGGANA
YQQQEYQRKPWQFNVPIPSTPSYVPTTRVSWDDTKIYATSSVLNSTAPSG
SSCLNSSLANGDAYYCTGSNHECCSGNDVVLIKVRQPRGKSLESLEDIHD
NSTRSHLTFSHYTTTDYGHFGPPTTAAAAAAMAAAATLQQQHHHQQLLHQ
QQQQAAAARLLGNNAPGIGWRRSYDDGDITPTNDATRELLYEQEGGGTLP
RQQRGILQRAVLNTMPPLEHHHYMNAAAAAEYGAASGVEGGANYMGGSPL
TGKKIAPEPPRRHCSIRNSRTLSGEGVPSGAAAQAHQQAAQQQQGQHMFY
GHTAQHWQQQQQQAGAGTGQQPIYANYATIQQTTAEIHCEKYHDSKSTSS
IDSIDTIPFANENTGTIKQRLLNRQELQGGGAGNNNVPGGGHPAHLHSSS
SSSSSSSTNTIANIAHSFHSLKSSSSLHDATLARSESMGSTASGGSALHL
RSPTLDMSNAGGSTAEPASSPEAAVPTVAINNGVPPKVSVNVLNDIGNML
ANLTDELDAMLEEEKRVGLNIDSE*

LD09801.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12308-PA 943 GF12308-PA 1..943 1..924 3282 84.7 Plus
Dana\GF20545-PA 256 GF20545-PA 29..85 467..523 310 96.5 Plus
Dana\GF20545-PA 256 GF20545-PA 128..242 615..730 213 57 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20494-PA 922 GG20494-PA 1..922 1..924 3882 97 Plus
Dere\GG13068-PA 87 GG13068-PA 1..87 838..924 426 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21106-PA 981 GH21106-PA 73..981 58..924 2980 79.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-PE 924 CG12424-PE 1..924 1..924 4867 100 Plus
ckn-PB 924 CG12424-PB 1..924 1..924 4867 100 Plus
ckn-PC 924 CG12424-PC 1..924 1..924 4867 100 Plus
ckn-PD 845 CG12424-PD 1..845 1..924 3348 74.2 Plus
ckn-PF 642 CG12424-PF 45..642 327..924 3133 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18708-PA 957 GI18708-PA 1..957 1..924 3137 79.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10381-PA 925 GL10381-PA 1..925 1..924 3230 83.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11625-PA 925 GA11625-PA 1..925 1..924 3236 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21586-PA 918 GM21586-PA 1..918 1..924 3909 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11093-PA 532 GD11093-PA 1..532 393..924 2817 99.6 Plus
Dsim\GD11092-PA 309 GD11092-PA 1..297 81..377 1566 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21728-PA 923 GJ21728-PA 1..923 1..924 3147 77.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19509-PA 927 GK19509-PA 1..927 1..924 2951 75.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13627-PA 928 GE13627-PA 1..928 1..924 3763 95.8 Plus

LD09801.hyp Sequence

Translation from 661 to 3435

> LD09801.hyp
MHRSLKPHASTAQAKKVQPPTIPGDSPQDLHLYQQPQQLHHHHHQHPNHH
HPHHQPSIPLYRLSGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGFNLP
RETSVALRLKDEVGGTSTAAPTTGGPGGGGATVVGAPPPGAGKPGVAMVP
PPPVFCATLREPLTHKAAVYYHQQLALQEDQGIDLTQSPGRDSPGSSSGS
AGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRCSSVSSCSIGS
VDRQRNDELIIDWLLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIK
NPHHRERIKQRIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLLEQNY
KTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDIISGKWNPGGANA
YQQQEYQRKPWQFNVPIPSTPSYVPTTRVSWDDTKIYATSSVLNSTAPSG
SSCLNSSLANGDAYYCTGSNHECCSGNDVVLIKVRQPRGKSLESLEDIHD
NSTRSHLTFSHYTTTDYGHFGPPTTAAAAAAMAAAATLQQQHHHQQLLHQ
QQQQAAAARLLGNNAPGIGWRRSYDDGDITPTNDATRELLYEQEGGGTLP
RQQRGILQRAVLNTMPPLEHHHYMNAAAAAEYGAASGVEGGANYMGGSPL
TGKKIAPEPPRRHCSIRNSRTLSGEGVPSGAAAQAHQQAAQQQQGQHMFY
GHTAQHWQQQQQQAGAGTGQQPIYANYATIQQTTAEIHCEKYHDSKSTSS
IDSIDTIPFANENTGTIKQRLLNRQELQGGGAGNNNVPGGGHPAHLHSSS
SSSSSSSTNTIANIAHSFHSLKSSSSLHDATLARSESMGSTASGGSALHL
RSPTLDMSNAGGSTAEPASSPEAAVPTVAINNGVPPKVSVNVLNDIGNML
ANLTDELDAMLEEEKRVGLNIDSE*

LD09801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-PE 924 CG12424-PE 1..924 1..924 4867 100 Plus
ckn-PB 924 CG12424-PB 1..924 1..924 4867 100 Plus
ckn-PC 924 CG12424-PC 1..924 1..924 4867 100 Plus
ckn-PD 845 CG12424-PD 1..845 1..924 3348 74.2 Plus
ckn-PF 642 CG12424-PF 45..642 327..924 3133 100 Plus