Clone LD10005 Report

Search the DGRC for LD10005

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:100
Well:5
Vector:pBS SK-
Associated Gene/Transcripttan-RA
Protein status:LD10005.pep: gold
Preliminary Size:1598
Sequenced Size:1480

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6586 2001-01-01 Release 2 assignment
CG6586 2001-11-09 Blastp of sequenced clone
CG6586 2003-01-01 Sim4 clustering to Release 3
tan 2008-04-29 Release 5.5 accounting
tan 2008-08-15 Release 5.9 accounting
tan 2008-12-18 5.12 accounting

Clone Sequence Records

LD10005.complete Sequence

1480 bp (1480 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069394

> LD10005.complete
TACAAAAAGAACACAAAAGTTATAATTCTGTCATTTAATTGTCTGCAAAA
TAGGACTTTCCAGCATCATTGCATGTAGTTAAATCCAGATTTCTGAAAAA
CCTTATTTGGCAGCGATATGTTTAGCCAAAAAATAGGAATTTGCGGATAA
ATTACCCCCCGGAGTGACAAAGATCTGTATTGTCATACAGACGCCTGCAG
AAAAAAGGGTTTTACAAGAAGAAAATGCGCTATTTTGCAAAGGAATGATT
TCTAGAATTCAACGTCAAATATAATGGATAACATAGTCTACGACTTTGCC
AAGATCACGTTTCAAGCAAAAGACAACAGGTCACCCACTACTAACTCGAA
TCTGTCGTGGCAACTAAATCAGATGGCCTTGTCGGACATGGAGGAGATGC
AGGACACATCCGAGCCCATAGCTCCACCCGAATCCGATGACAATGTCAGC
AGTGAATCGCATGACTCCGACGATGTAGACTCGCAATTGAGTCGCTGCGA
GGACAACGATGACGACAGCGATTGCATCAGTGGATCCTCCAGACGCAGTT
CCACTTTTGGAGCTCGAGCGGGCGTGGCTCGTCGCAGAATGCCCGCCAGG
GTGTCCAAGGACAACTTTAACCGGATCTGCAGCGCCATCATGAAACCCAT
CAAAAAGAAGCAACGCAAAGAACTGAACACAAATGCCCAAACACTTAAAA
GCATCGAAAAGATCTACACCAGCAGGCGCATGAAAAAGTTCACGCCCACC
AATCTGGAGACAATCTTCGAGGAACCCAGCGATGAGAATGCCGCCGATGC
AGAGGACGACAGCGAAGAGTGCTCCATCAGCAGCCAAGTGAAAGTAGTTA
AGGTGTGGGGTCGCAAACTCCGCCGGGCAATATCCTTCAGCGATGGCCTG
AACAAGAACAAAATCCTGTCGAAGAGACGCCGCCAGAAGGTGAAGAAGAC
CTTTGGCAAGCGTTTCGCACTCAAGAAAATCTCCATGACCGAGTTCCACG
ATCGTCTGAATAAGAGCTTCGACAGTGCCATGCTGGAGGGGGATGATGCA
GAGGCGGGAGGATCGGCGGAGGCCGTCAACATCCCCAAGACATCCATGAC
CATGGAAGACATACAGCTGCCGACAATGAGCAGCCAGCACCAGTTCCTCA
TGCAACCGGCGGGCTTTGAGTAGAGAGACTGAATGATCCATCAAATACGC
CCCACATTGATTTGCATTGCATTAAAACTAGCTAATAGTGCCCAAAAATA
AATGTACTGATTACCAATTATGAAGTTAGGATTTACGTTCGTTTGGTTAA
CTTCTCACCTTAGTCTTAAGCCCCATAAAAGTTATAAATGAGTGTAAATA
GCATGTAGAAGAAAAGAAAATAAGAGCTATACCTAGAGCTAAACTTATCC
AGCCATAGAATACGATTCTGTGCTTAGCCATTAAGATAATAAATAAAAGT
TGAAAATAAAAAAAAAAAAAAAAAAAAAAA

LD10005.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RA 1671 tan-RA 54..1511 1..1458 7290 100 Plus
tan.b 1446 tan.b 245..1446 254..1455 6010 100 Plus
tan.a 1416 tan.a 331..1416 370..1455 5430 100 Plus
tan.a 1416 tan.a 5..333 1..329 1645 100 Plus
tan.b 1446 tan.b 5..246 1..242 1210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6048348..6049478 327..1457 5550 99.4 Plus
chr3L 24539361 chr3L 6047812..6048054 1..243 1170 98.8 Plus
chr3L 24539361 chr3L 6048209..6048299 241..331 455 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 900 CG6586-PB 1..900 274..1173 4500 100 Plus
tan-RA 900 CG6586-PA 1..900 274..1173 4500 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 1657 CG6586-RB 43..1499 1..1457 7285 100 Plus
tan-RA 1494 CG6586-RA 43..1494 1..1452 7260 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
tan-PB 299 CG6586-PB 1..299 274..1170 1070 100 Plus
tan-PA 299 CG6586-PA 1..299 274..1170 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6055714..6056845 327..1458 5660 100 Plus
3L 28110227 3L 6055178..6055420 1..243 1215 100 Plus
3L 28110227 3L 6055575..6055665 241..331 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6048814..6049945 327..1458 5660 100 Plus
3L 28103327 3L 6048278..6048520 1..243 1215 100 Plus
3L 28103327 3L 6048675..6048765 241..331 455 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:42:24 has no hits.

LD10005.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:51:13 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6048351..6049478 330..1457 99   Plus
chr3L 6048211..6048297 243..329 100 -> Plus
chr3L 6047812..6048053 1..242 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:16 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 274..1173 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:28:53 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 274..1173 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:10 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 274..1173 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:56:29 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 274..1173 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:13 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 274..1173 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:06:13 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..1455 1..1455 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:28:53 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..1455 1..1455 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:10 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RB 43..1499 1..1457 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:56:29 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..1455 1..1455 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:13 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RB 43..1499 1..1457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:51:13 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6055717..6056844 330..1457 100   Plus
3L 6055577..6055663 243..329 100 -> Plus
3L 6055178..6055419 1..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:10 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6048817..6049944 330..1457 100   Plus
arm_3L 6048677..6048763 243..329 100 -> Plus
arm_3L 6048278..6048519 1..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:32:39 Download gff for LD10005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6048817..6049944 330..1457 100   Plus
3L 6048677..6048763 243..329 100 -> Plus
3L 6048278..6048519 1..242 100 -> Plus

LD10005.pep Sequence

Translation from 273 to 1172

> LD10005.pep
MDNIVYDFAKITFQAKDNRSPTTNSNLSWQLNQMALSDMEEMQDTSEPIA
PPESDDNVSSESHDSDDVDSQLSRCEDNDDDSDCISGSSRRSSTFGARAG
VARRRMPARVSKDNFNRICSAIMKPIKKKQRKELNTNAQTLKSIEKIYTS
RRMKKFTPTNLETIFEEPSDENAADAEDDSEECSISSQVKVVKVWGRKLR
RAISFSDGLNKNKILSKRRRQKVKKTFGKRFALKKISMTEFHDRLNKSFD
SAMLEGDDAEAGGSAEAVNIPKTSMTMEDIQLPTMSSQHQFLMQPAGFE*

LD10005.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10670-PA 307 GF10670-PA 1..307 1..299 1105 77.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15310-PA 298 GG15310-PA 1..298 1..299 1460 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15029-PA 302 GH15029-PA 1..302 1..299 698 56.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
tan-PB 299 CG6586-PB 1..299 1..299 1525 100 Plus
tan-PA 299 CG6586-PA 1..299 1..299 1525 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16682-PA 231 GI16682-PA 3..223 56..282 666 68.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10545-PA 291 GL10545-PA 1..277 1..289 947 69.9 Plus
Dper\GL15541-PA 218 GL15541-PA 1..193 36..243 747 75.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19704-PA 295 GA19704-PA 1..281 1..289 934 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14744-PA 177 GM14744-PA 1..177 123..299 908 96 Plus
Dsec\GM14743-PA 107 GM14743-PA 1..106 1..107 512 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13925-PA 298 GD13925-PA 1..298 1..299 1513 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12933-PA 298 GJ12933-PA 1..290 1..282 693 59.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16901-PA 285 GK16901-PA 40..276 55..286 651 64.3 Plus
Dwil\GK16900-PA 466 GK16900-PA 40..245 55..254 640 69.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21531-PA 298 GE21531-PA 1..298 1..299 1422 92.3 Plus

LD10005.hyp Sequence

Translation from 273 to 1172

> LD10005.hyp
MDNIVYDFAKITFQAKDNRSPTTNSNLSWQLNQMALSDMEEMQDTSEPIA
PPESDDNVSSESHDSDDVDSQLSRCEDNDDDSDCISGSSRRSSTFGARAG
VARRRMPARVSKDNFNRICSAIMKPIKKKQRKELNTNAQTLKSIEKIYTS
RRMKKFTPTNLETIFEEPSDENAADAEDDSEECSISSQVKVVKVWGRKLR
RAISFSDGLNKNKILSKRRRQKVKKTFGKRFALKKISMTEFHDRLNKSFD
SAMLEGDDAEAGGSAEAVNIPKTSMTMEDIQLPTMSSQHQFLMQPAGFE*

LD10005.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
tan-PB 299 CG6586-PB 1..299 1..299 1525 100 Plus
tan-PA 299 CG6586-PA 1..299 1..299 1525 100 Plus