Clone LD10322 Report

Search the DGRC for LD10322

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:103
Well:22
Vector:pBS SK-
Associated Gene/Transcriptsubdued-RA
Protein status:LD10322.pep: gold
Preliminary Size:3860
Sequenced Size:4080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16718 2001-01-01 Release 2 assignment
CG16718 2003-01-01 Sim4 clustering to Release 3
CG16718 2003-08-11 Blastp of sequenced clone
CG16718 2008-04-29 Release 5.5 accounting
CG16718 2008-08-15 Release 5.9 accounting
CG16718 2008-12-18 5.12 accounting

Clone Sequence Records

LD10322.complete Sequence

4080 bp (4080 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010299

> LD10322.complete
CCACCATCTGAGCACTTTGTTAGTTTGTTACAGAACATTGGTAGAAACGG
TTTTTCGCTCTGTTGTCGCTCGCTAAATCAGCGAAAATTAATTCATTCAT
AATTATAAAATAATAAATGAGTGTAAAGTGCAATAGGAGGGTGTGATATT
AGTAGTACTAGTTTAATGAACGGCAAAGATGAAAGTTGATTGCTAAATTT
CTGGCCACCAACGCACACAGATGCAGATGCCTTGTGAAAGCACCGCAGAA
GAGGAAGAGCGAAAAAGAAGAGAGAATGCGATTTAGCGAAACTGACTAAA
TTTAGGAATTTCTCAGAAACAAGATGCTAAATTTAGGCAGTGCCAAAGTT
GGCGCTCTGGAGGAGGCCACCTCACCACCCCCCTTCTCCAAGGACGAGAG
CTTCCAGCTGTTGGAGCGGAGCCCCCACAATCCCGCCATATCACCCACCA
CCACTGTCCCGCTGGAGCCCCCCTTCACCACCCCCCTAGCTCCCTTCGAC
ATGGAGCTGATGAAGCGCCACAATCTCCACGAGCGCTTAACGGGAAAGGA
GAGCTTCTGGCGCGGGCGCGACACTTCGCAGAGATTTCTGGACCAGGAGC
AATTATCAGCATCGCGTGAATCACTCGGTGCCGCCGACAAGAGAGCCCGG
TTTGCAGAAAGCAACGCCCCCACGCTCCAACTGCCAGAATCTGCCGAGCC
CAGGGCCAATGGCAAAAGACCCACTGGGAACAGGACCAACCCATCGAATC
CAGCCGCTCCCCTTCTGCCAATGACTGATCCGGATTTTGTGAAGGGCAAT
GTAGGCGGCGTCTACGATGATCGCGAGTGCAGCTGCCCCAGGGAGTTCTA
CCAGCGGGGCGAGATTAACACATCACTGTTCTTTGAGGACTGCGTCCGGT
CCATTGACTTTGTCCTGGCCTACAGGATCAATGCGCACGAGCCCACGGAG
CTGGAGAACACGGAAAAGCGTCGTGTTTTCGAGGCGAATCTCATTAGTCA
GGGGCTGGAGGTCGAGTCCAGTCAGAAGGACCAGATCTGGTTCGTTAAGA
TCCACGCTCCTTTGGAGGTCCTGCGACGGTATGCGGAAATTCTTAAGCTG
CGCATGCCCATGAAGGAGATTCCAGGAATGTCCGTGGTCAATCGATCGAC
CAAAAGCGTGTTTTCTAGTCTTAAACATGTTTTCCAATTCTTTCTGCGCA
ACATTTATGTGGACGAGGAAATTTTTCCAAAGCGAGCTCATCGATTCACT
GCCATTTACAGTCGCGATAAGGAGTATCTCTTTGACATCCGACAGGATTG
TTTCTTTACCACCGCCGTCCGTTCCCGCATCGTTGAGTTCATCCTAGATC
GCCAGCGATTTCCTGCCAAGAATCAACATGACATGGCCTTCGGTATTGAG
CGACTGATTGCCGAGGGTGTCTACTCTGCTGCCTATCCACTCCATGATGG
TGAAATAACCGAGACGGGAACCATGAGAGCTCTGCTGTACAAACATTGGG
CCTCTGTGCCCAAATGGTATCGCTATCAGCCCTTGGATGACATCAAGGAA
TACTTCGGTGTCAAAATTGGCTTGTACTTCGCCTGGCTGGGCTACTACAC
CTACATGTTGCTGCTGGCCTCAATAGTGGGTGTCATTTGTTTCCTATATT
CATGGTTCTCCCTTAAAAACTATGTGCCTGTGAAAGATATTTGCCAGAGC
GGTAATACAAACATAACCATGTGTCCTCTTTGTGATTGGTGCAACTTTTG
GGACCTGAAAGAGACCTGCAACTATGCCAAAGTCACGTACCTCATTGACA
ATCCCAGCACCGTGTTCTTCGCCGTTTTTATGTCCTTTTGGGCCACCCTA
TTTCTGGAGCTGTGGAAGCGGTACTCCGCCGAAATAACGCATCGTTGGGA
TCTGACGGGATTCGATGTGCATGAAGAGCATCCGAGGCCACAATATCTGG
CGCGTTTGGAGCACATACCACCGACGAGAGTGGATTATGTGACCAATATA
AAAGAGCCAACGGTTCCCTTTTGGCGTATGAAACTTCCCGCCACCGTGTT
CAGCTTTTCAGTGGTACTGCTCCTAATTGCACTGGCCTTTGTGGCACTGC
TGGCAGTGGTTGTATACCGAATGTCCATGCTGGCCGCCCTTAAAGTGGGT
GCTAGTCCCATGACCACCTCTAGCGCTATTGTCCTAGCCACTGCATCAGC
TGCCTTTGTAAATCTGTGCCTGCTCTATATACTTAATTATATGTACAATC
ATTTGGCTGAGTACCTGACAGAGCTGGAAATGTGGCGCACTCAAACTCAG
TTCGATGACTCGCTTACCCTTAAAATTTATCTGCTGCAGTTTGTAAACTA
CTACGCCTCCATTTTTTACATAGCTTTCTTCAAGGGTAAATTCGTTGGTC
ATCCGGGAGAGTATAATAAGCTTTTTGACTATCGGCAGGAGGAGTGCTCA
TCGGGCGGCTGTTTGACGGAGCTGTGCATCCAGTTAGCCATTATAATGGT
TGGCAAGCAGGCATTCAACACTATTCTTGAAGTGTATCTTCCCATGTTCT
GGCGAAAGGTTTTGGCCATTCAGGTGGGACTGTCGCGACTTTTCAACAAC
ACCCCGAATCCAGACAAGGCGAAAGACGAACGCTGGATGCGGGATTTCAA
GCTACTGGATTGGGGTGCCCGAGGTCTGTTTCCCGAGTATTTGGAGATGG
TCTTGCAGTACGGCTTCGTAACCATCTTTGTGGCCGCTTTTCCGCTGGCG
CCATTCTTTGCCCTGCTAAATAATATCCTGGAAATGCGACTGGATGCAAA
GAAACTATTGACCCACCACAAGCGTCCAGTATCACAGCGAGTTCGAGATA
TAGGAGTGTGGTATCGTATCCTGGACTGCATAGGCAAGCTCAGCGTGATC
ACAAATGGATTCATCATTGCCTTTACCTCTGACATGATACCGCGGTTGGT
GTACCGGCATTACGTAAACAAGCAAGGCACTCTGGATGGTTACCTCAACT
TTACACTATCAGAGTTCAAAGTCATTGATTCGCCCACGTTGTATAGCTTA
GCTGGCGATCTCTCCAACATAACAACGTGCAGATATACGGACTTTCGACT
TCCACCATCGTCTCCAGAAAAATACACATTGAGCAGCATGTTCTACATAA
TTCTGGCCTGCCGATTGGGTTTTGTAGTCGTCTTTGAAAACTTTGTTGCC
CTGGTGATGATTTTGGTGCGTTGGTGCATTCCGGACATGAGCGTTGAACT
GCGTGACCAAATCCGACGCGAAGTTTATGTGACCAATGAAATTATCATCG
ATCAAGAGGCCCACAGGGCTCGTTTTGAGCGTGCCAAGCGCAGCAGTTCG
GTGCTCCAGACGCCAGTTGACCAGGACATGGATGCTGCCTCCATTCAAGA
GCCTAATGCCAAGTTCATTAACATTGAAAAGCTCCTTACTGAAAATCTCA
CACAGATCGAAATGGATGCTATTATACACGGCGAAAATCCAATCACAGGA
ATTTCCGGTGCCGATTGCTTAGACGAAGTGCACAAAAAACTCAGTGACTA
AGTTAAAAATCATTCAAAGTGATTATTTGTGTTACGAATGTTCCTTTCAG
TCACTTAATTAGGCCTTAGCTATGACACTTTTATTATTATTTAGTAACCC
TTAGAAATTTGTTTGATACTTGGTTACAAGCTTTACTCATGCTTTATTTT
ATTGTAAGAGCCCAGTAATTGTTATTTAGGTAATCCAATTTTATGATCTG
TTAATTGAAAATGATTTATTAAGTGGCTCAAACTTATATTTATGCAGCCC
AAGTGAGTGCCAATCTGTAAACGAGCACAACTCATATACTTTTATAATTA
ATTGCATATTACGAAATGTTAAAAGTAATCTCTCATTCGTGTTAAAAAAC
TCAGGCTCTCAAATGACGCGTACATGAACATTTATTTTAGATAGCGTGAC
ATATATACATGTATTTATTGCATACATTAAACCGTATGTATGTATATTGA
TGTTGATATACTGGAATCTCTATTCAATGTTGAATATATCAATAAACAAA
TAGTCAAATATTAAAAAAAAAAAAAAAAAA

LD10322.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG16718-RA 4104 CG16718-RA 7..4068 1..4062 20310 100 Plus
CG16718-RB 3581 CG16718-RB 143..3545 660..4062 17015 100 Plus
CG16718.a 773 CG16718.a 87..545 660..1118 2295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15457254..15457989 4062..3327 3680 100 Minus
chr3R 27901430 chr3R 15465933..15466593 661..1 3170 98.6 Minus
chr3R 27901430 chr3R 15460896..15461454 2240..1682 2675 98.6 Minus
chr3R 27901430 chr3R 15460113..15460577 2907..2443 2235 98.7 Minus
chr3R 27901430 chr3R 15462862..15463251 1049..660 1905 99.2 Minus
chr3R 27901430 chr3R 15460635..15460842 2444..2237 995 98.6 Minus
chr3R 27901430 chr3R 15459876..15460051 3082..2907 880 100 Minus
chr3R 27901430 chr3R 15461861..15462030 1449..1280 850 100 Minus
chr3R 27901430 chr3R 15462103..15462265 1279..1117 800 99.4 Minus
chr3R 27901430 chr3R 15458048..15458186 3327..3189 695 100 Minus
chr3R 27901430 chr3R 15461686..15461807 1570..1449 595 99.2 Minus
chr3R 27901430 chr3R 15461511..15461628 1686..1569 575 99.2 Minus
chr3R 27901430 chr3R 15459713..15459821 3188..3080 545 100 Minus
chr3R 27901430 chr3R 15462737..15462807 1118..1048 355 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-RA 3228 CG16718-PA 1..3228 324..3551 16140 100 Plus
subdued-RE 2781 CG16718-PE 1..2781 771..3551 13905 100 Plus
subdued-RB 2781 CG16718-PB 1..2781 771..3551 13905 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-RA 4046 CG16718-RA 1..4046 17..4062 20230 100 Plus
subdued-RB 3531 CG16718-RB 129..3531 660..4062 17015 100 Plus
subdued-RE 3504 CG16718-RE 104..3504 662..4062 17005 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-PA 1075 CG16718-PA 1..1075 324..3548 5461 100 Plus
subdued-PD 1099 CG16718-PD 1..1099 324..3548 5426 97.8 Plus
subdued-PE 926 CG16718-PE 1..926 771..3548 4685 100 Plus
subdued-PB 926 CG16718-PB 1..926 771..3548 4685 100 Plus
subdued-PF 950 CG16718-PF 1..950 771..3548 4650 97.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19633418..19634153 4062..3327 3680 100 Minus
3R 32079331 3R 19642078..19642738 661..1 3305 100 Minus
3R 32079331 3R 19637060..19637618 2240..1682 2795 100 Minus
3R 32079331 3R 19636277..19636741 2907..2443 2325 100 Minus
3R 32079331 3R 19639026..19639415 1049..660 1950 100 Minus
3R 32079331 3R 19636799..19637006 2444..2237 1025 99.5 Minus
3R 32079331 3R 19636040..19636215 3082..2907 880 100 Minus
3R 32079331 3R 19638025..19638194 1449..1280 850 100 Minus
3R 32079331 3R 19638267..19638429 1279..1117 815 100 Minus
3R 32079331 3R 19634212..19634350 3327..3189 695 100 Minus
3R 32079331 3R 19637850..19637971 1570..1449 610 100 Minus
3R 32079331 3R 19637675..19637792 1686..1569 575 99.2 Minus
3R 32079331 3R 19635877..19635985 3188..3080 545 100 Minus
3R 32079331 3R 19638901..19638971 1118..1048 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19374249..19374984 4062..3327 3680 100 Minus
3R 31820162 3R 19382909..19383569 661..1 3305 100 Minus
3R 31820162 3R 19377891..19378449 2240..1682 2795 100 Minus
3R 31820162 3R 19377108..19377572 2907..2443 2325 100 Minus
3R 31820162 3R 19379857..19380246 1049..660 1950 100 Minus
3R 31820162 3R 19377630..19377837 2444..2237 1025 99.5 Minus
3R 31820162 3R 19376871..19377046 3082..2907 880 100 Minus
3R 31820162 3R 19378856..19379025 1449..1280 850 100 Minus
3R 31820162 3R 19379098..19379260 1279..1117 815 100 Minus
3R 31820162 3R 19375043..19375181 3327..3189 695 100 Minus
3R 31820162 3R 19378681..19378802 1570..1449 610 100 Minus
3R 31820162 3R 19378506..19378623 1686..1569 575 99.1 Minus
3R 31820162 3R 19376708..19376816 3188..3080 545 100 Minus
3R 31820162 3R 19379732..19379802 1118..1048 355 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:49:38 has no hits.

LD10322.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:53:59 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15465933..15466593 1..661 93   Minus
chr3R 15462862..15463249 662..1049 99 <- Minus
chr3R 15462737..15462805 1050..1118 100 <- Minus
chr3R 15462103..15462263 1119..1279 99 <- Minus
chr3R 15461862..15462030 1280..1448 100 <- Minus
chr3R 15461687..15461807 1449..1569 99 <- Minus
chr3R 15461516..15461627 1570..1681 100 <- Minus
chr3R 15460896..15461454 1682..2240 98 <- Minus
chr3R 15460635..15460838 2241..2444 99 <- Minus
chr3R 15460114..15460575 2445..2906 98 <- Minus
chr3R 15459876..15460051 2907..3082 100 <- Minus
chr3R 15459713..15459818 3083..3188 100 <- Minus
chr3R 15458048..15458186 3189..3327 100 <- Minus
chr3R 15457254..15457988 3328..4062 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:39 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 1..3228 324..3551 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:15 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 1..3228 324..3551 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:21 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 1..3228 324..3551 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:45 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 1..3228 324..3551 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:53:59 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
subdued-RA 1..3228 324..3551 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:57 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 7..4068 1..4062 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:15 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 7..4068 1..4062 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:21 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 1..4046 17..4062 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:45 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 7..4068 1..4062 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:53:59 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
subdued-RA 1..4046 17..4062 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:53:59 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19642078..19642738 1..661 100   Minus
3R 19639026..19639413 662..1049 100 <- Minus
3R 19638901..19638969 1050..1118 100 <- Minus
3R 19638267..19638427 1119..1279 100 <- Minus
3R 19638026..19638194 1280..1448 100 <- Minus
3R 19637851..19637971 1449..1569 100 <- Minus
3R 19637680..19637791 1570..1681 100 <- Minus
3R 19637060..19637618 1682..2240 100 <- Minus
3R 19636799..19637002 2241..2444 100 <- Minus
3R 19636278..19636739 2445..2906 100 <- Minus
3R 19636040..19636215 2907..3082 100 <- Minus
3R 19635877..19635982 3083..3188 100 <- Minus
3R 19634212..19634350 3189..3327 100 <- Minus
3R 19633418..19634152 3328..4062 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:21 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15467800..15468460 1..661 100   Minus
arm_3R 15464748..15465135 662..1049 100 <- Minus
arm_3R 15464623..15464691 1050..1118 100 <- Minus
arm_3R 15463989..15464149 1119..1279 100 <- Minus
arm_3R 15463748..15463916 1280..1448 100 <- Minus
arm_3R 15463573..15463693 1449..1569 100 <- Minus
arm_3R 15463402..15463513 1570..1681 100 <- Minus
arm_3R 15462782..15463340 1682..2240 100 <- Minus
arm_3R 15462521..15462724 2241..2444 100 <- Minus
arm_3R 15462000..15462461 2445..2906 100 <- Minus
arm_3R 15461762..15461937 2907..3082 100 <- Minus
arm_3R 15461599..15461704 3083..3188 100 <- Minus
arm_3R 15459934..15460072 3189..3327 100 <- Minus
arm_3R 15459140..15459874 3328..4062 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:35 Download gff for LD10322.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19382909..19383569 1..661 100   Minus
3R 19379857..19380244 662..1049 100 <- Minus
3R 19379732..19379800 1050..1118 100 <- Minus
3R 19379098..19379258 1119..1279 100 <- Minus
3R 19378857..19379025 1280..1448 100 <- Minus
3R 19378682..19378802 1449..1569 100 <- Minus
3R 19378511..19378622 1570..1681 100 <- Minus
3R 19377891..19378449 1682..2240 100 <- Minus
3R 19377630..19377833 2241..2444 100 <- Minus
3R 19377109..19377570 2445..2906 100 <- Minus
3R 19376871..19377046 2907..3082 100 <- Minus
3R 19376708..19376813 3083..3188 100 <- Minus
3R 19375043..19375181 3189..3327 100 <- Minus
3R 19374249..19374983 3328..4062 100 <- Minus

LD10322.pep Sequence

Translation from 323 to 3550

> LD10322.pep
MLNLGSAKVGALEEATSPPPFSKDESFQLLERSPHNPAISPTTTVPLEPP
FTTPLAPFDMELMKRHNLHERLTGKESFWRGRDTSQRFLDQEQLSASRES
LGAADKRARFAESNAPTLQLPESAEPRANGKRPTGNRTNPSNPAAPLLPM
TDPDFVKGNVGGVYDDRECSCPREFYQRGEINTSLFFEDCVRSIDFVLAY
RINAHEPTELENTEKRRVFEANLISQGLEVESSQKDQIWFVKIHAPLEVL
RRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEI
FPKRAHRFTAIYSRDKEYLFDIRQDCFFTTAVRSRIVEFILDRQRFPAKN
QHDMAFGIERLIAEGVYSAAYPLHDGEITETGTMRALLYKHWASVPKWYR
YQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNY
VPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPSTVFFA
VFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPP
TRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRM
SMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTE
LEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKL
FDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQ
VGLSRLFNNTPNPDKAKDERWMRDFKLLDWGARGLFPEYLEMVLQYGFVT
IFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRIL
DCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKV
IDSPTLYSLAGDLSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGF
VVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR
FERAKRSSSVLQTPVDQDMDAASIQEPNAKFINIEKLLTENLTQIEMDAI
IHGENPITGISGADCLDEVHKKLSD*

LD10322.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18455-PA 1080 GF18455-PA 1..1080 1..1065 5026 86.6 Plus
Dana\GF21590-PA 1045 GF21590-PA 206..1015 187..999 1684 42.3 Plus
Dana\GF25308-PA 1228 GF25308-PA 337..1165 184..1000 1476 39.1 Plus
Dana\GF14339-PA 1335 GF14339-PA 169..724 243..875 453 26.6 Plus
Dana\GF21728-PA 646 GF21728-PA 163..566 357..861 299 23.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15908-PA 1075 GG15908-PA 1..1075 1..1075 5679 97.5 Plus
Dere\GG18823-PA 1052 GG18823-PA 206..1015 187..999 1665 41.6 Plus
Dere\GG15549-PA 1219 GG15549-PA 328..1156 184..1000 1467 38.5 Plus
Dere\GG25146-PA 1347 GG25146-PA 156..711 243..875 453 26.4 Plus
Dere\GG18235-PA 646 GG18235-PA 28..566 209..861 319 22.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22385-PA 1070 GH22385-PA 1..1070 1..1065 4231 75 Plus
Dgri\GH12469-PA 1023 GH12469-PA 172..975 187..999 1673 41.2 Plus
Dgri\GH17132-PA 1232 GH17132-PA 341..1169 184..1000 1449 38 Plus
Dgri\GH10918-PA 1791 GH10918-PA 671..1141 365..875 447 27.9 Plus
Dgri\GH11928-PA 630 GH11928-PA 161..581 358..881 293 23.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-PA 1075 CG16718-PA 1..1075 1..1075 5654 100 Plus
subdued-PD 1099 CG16718-PD 1..1099 1..1075 5619 97.8 Plus
subdued-PE 926 CG16718-PE 1..926 150..1075 4878 100 Plus
subdued-PB 926 CG16718-PB 1..926 150..1075 4878 100 Plus
subdued-PF 950 CG16718-PF 1..950 150..1075 4843 97.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24621-PA 1068 GI24621-PA 30..1068 23..1065 4332 79.1 Plus
Dmoj\GI11145-PA 1237 GI11145-PA 168..963 192..995 1712 42 Plus
Dmoj\GI11146-PA 987 GI11146-PA 152..941 192..995 1671 41.5 Plus
Dmoj\GI11741-PA 1243 GI11741-PA 352..1180 184..1000 1467 38.7 Plus
Dmoj\GI15349-PA 643 GI15349-PA 161..564 357..861 298 24 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11957-PA 996 GL11957-PA 1..995 1..1064 4470 80.3 Plus
Dper\GL25113-PA 1203 GL25113-PA 312..1140 184..1000 1451 38.2 Plus
Dper\GL20401-PA 800 GL20401-PA 197..754 187..746 1273 43.2 Plus
Dper\GL26028-PA 1355 GL26028-PA 164..720 243..875 442 26.1 Plus
Dper\GL12944-PA 644 GL12944-PA 159..564 357..861 308 24 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14102-PA 1063 GA14102-PA 1..1062 1..1064 4897 86.4 Plus
Dpse\GA14102-PB 912 GA14102-PB 1..911 150..1064 4598 93.3 Plus
Dpse\GA10267-PA 988 GA10267-PA 149..986 187..1023 1681 40.8 Plus
Dpse\GA19969-PA 1236 GA19969-PA 345..1173 184..1000 1454 38.2 Plus
Dpse\GA13617-PA 1355 GA13617-PA 164..720 243..875 447 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26900-PA 1055 GM26900-PA 1..1055 1..1075 5502 95.8 Plus
Dsec\GM15927-PA 1350 GM15927-PA 159..720 243..875 456 26.8 Plus
Dsec\GM13589-PA 351 GM13589-PA 152..338 187..375 335 38.6 Plus
Dsec\GM13377-PA 646 GM13377-PA 28..566 209..861 316 23.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20108-PA 1075 GD20108-PA 1..1075 1..1075 5740 98.7 Plus
Dsim\GD14349-PA 1219 GD14349-PA 328..1175 184..1024 1463 37.8 Plus
Dsim\GD15959-PA 545 GD15959-PA 109..508 599..999 792 41.6 Plus
Dsim\GD23993-PA 1349 GD23993-PA 159..720 243..875 455 26.8 Plus
Dsim\GD15734-PA 646 GD15734-PA 28..566 209..861 316 23.1 Plus
Dsim\GD15959-PA 545 GD15959-PA 3..107 277..398 176 34.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24534-PA 1063 GJ24534-PA 25..1063 18..1065 4490 81 Plus
Dvir\GJ18522-PA 1018 GJ18522-PA 169..997 187..1031 1763 41.5 Plus
Dvir\GJ11413-PA 1235 GJ11413-PA 344..1172 184..1000 1462 38.6 Plus
Dvir\GJ11911-PA 390 GJ11911-PA 325..387 784..846 184 54 Plus
Dvir\GJ11911-PA 390 GJ11911-PA 35..213 497..686 173 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12071-PA 1060 GK12071-PA 26..1060 33..1065 4663 84.5 Plus
Dwil\GK25421-PA 1018 GK25421-PA 171..1006 187..1030 1734 41.5 Plus
Dwil\GK16934-PA 1259 GK16934-PA 368..1196 184..1000 1469 38.8 Plus
Dwil\GK18314-PA 1365 GK18314-PA 173..725 243..875 459 26.9 Plus
Dwil\GK19948-PA 651 GK19948-PA 203..571 403..861 293 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25120-PA 1075 GE25120-PA 1..1075 1..1075 5656 97.3 Plus
Dyak\GE17587-PA 1052 GE17587-PA 206..1015 187..999 1659 41.7 Plus
Dyak\GE21872-PA 1229 GE21872-PA 338..1166 184..1000 1464 38.5 Plus
Dyak\GE20847-PA 1343 GE20847-PA 153..708 243..875 448 26.6 Plus
Dyak\GE15653-PA 646 GE15653-PA 28..566 209..861 301 22.4 Plus

LD10322.hyp Sequence

Translation from 323 to 3550

> LD10322.hyp
MLNLGSAKVGALEEATSPPPFSKDESFQLLERSPHNPAISPTTTVPLEPP
FTTPLAPFDMELMKRHNLHERLTGKESFWRGRDTSQRFLDQEQLSASRES
LGAADKRARFAESNAPTLQLPESAEPRANGKRPTGNRTNPSNPAAPLLPM
TDPDFVKGNVGGVYDDRECSCPREFYQRGEINTSLFFEDCVRSIDFVLAY
RINAHEPTELENTEKRRVFEANLISQGLEVESSQKDQIWFVKIHAPLEVL
RRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEI
FPKRAHRFTAIYSRDKEYLFDIRQDCFFTTAVRSRIVEFILDRQRFPAKN
QHDMAFGIERLIAEGVYSAAYPLHDGEITETGTMRALLYKHWASVPKWYR
YQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNY
VPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPSTVFFA
VFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPP
TRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRM
SMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTE
LEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKL
FDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQ
VGLSRLFNNTPNPDKAKDERWMRDFKLLDWGARGLFPEYLEMVLQYGFVT
IFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRIL
DCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKV
IDSPTLYSLAGDLSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGF
VVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR
FERAKRSSSVLQTPVDQDMDAASIQEPNAKFINIEKLLTENLTQIEMDAI
IHGENPITGISGADCLDEVHKKLSD*

LD10322.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-PA 1075 CG16718-PA 1..1075 1..1075 5654 100 Plus
subdued-PD 1099 CG16718-PD 1..1099 1..1075 5619 97.8 Plus
subdued-PE 926 CG16718-PE 1..926 150..1075 4878 100 Plus
subdued-PB 926 CG16718-PB 1..926 150..1075 4878 100 Plus
subdued-PF 950 CG16718-PF 1..950 150..1075 4843 97.5 Plus