Clone LD10532 Report

Search the DGRC for LD10532

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:105
Well:32
Vector:pBS SK-
Associated Gene/Transcriptemc-RA
Protein status:LD10532.pep: gold
Preliminary Size:2099
Sequenced Size:2046

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1007 2001-01-01 Release 2 assignment
CG1007 2001-11-09 Blastp of sequenced clone
CG1007 2003-01-01 Sim4 clustering to Release 3
emc 2008-04-29 Release 5.5 accounting
emc 2008-08-15 Release 5.9 accounting
emc 2008-12-18 5.12 accounting

Clone Sequence Records

LD10532.complete Sequence

2046 bp (2046 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069405

> LD10532.complete
CTCGCAGCAAAAGATATAGAAATCGAGAACGTAAACGCAGAAAACACGCT
GGATTAAAGTGTTTCGTTTCGAACATCGACAGAGTGAGAAAACAAAGTGA
AGTGAGCGCACAAAGCCGAAATCAAATCAAATTGAAAAGCCAGTCAAGAG
CAATCTTTAACTGAACCTCGCAAGTAATCCGGTACGACCGTGTAACAACC
GCCAAGATTCTACTCAAGGAGCGTAAAGCAATCATCTCCAGAATGAAGTC
CCTGACGGCCGTCTGCCAGACAGGTGCCTCCGGAATGCCGGCCTTGAATG
CCAGCGGGCGCATCCAGCGCCATCCCACGCACCGCGGCGACGGGGAGAAC
GCCGAGATGAAGATGTATCTGTCCAAACTGAAGGACCTCGTTCCGTTCAT
GCCCAAGAACAGGAAGCTCACCAAGCTGGAGATCATCCAGCACGTCATCG
ACTACATCTGCGACCTGCAGACCGAGCTGGAGACGCACCCCGAGATGGGC
AACTTCGATGCGGCAGCCGCTCTGACGGCGGTGAACGGACTCCACGAGGA
CGAGGACAGCGACATGGAGGATGCGGATGCCGAGGCAGAAGCGGAAGTCG
ATCCAGATATCCTCGCCCAGCGCCTGAATGCCGAGCAGCCGGCGAAAGTC
TCTAGTCCCGCCGCCCGTCTCCCGCTTACCGATCGCCAAACGCCCAACAC
TCTTGTGGCGCCCGCCCATCCGCAGCAGCATCAGCAGCAGCAGCAACTGC
AACTGCAGCAGCAACAACTGCAATCACAGCAGCAACTGTCCAACAGTTTA
GCAACGCCACAGAATGCGGAGAAAGACAGCAGACAGTCGTAAGCGTGGAA
ACGCCCAGCCGGGAAAACCCACGGAACCTATAAGCCTATTAACTAAATGC
ATAATGAAAGTACAGTCAAAACTCCACTCGCAACCTTCGTGTGAAGATCT
CCGCATAAGATAACGTGTGAAACTCTCAAGAAAACCACAGCCCAGGCGCA
TCTCTTCAACGCTCCTTTTCCCGGGAAACGGAAAACCCGGGAAAACGAGA
CCTCGCTTTTGGCTCCAACAGAGTTTAGTTTAAACATTTAATAACAAGAA
TACAACAACACAAAACCTAGCATTAGAGCAGCGTAAGCAAGTACACATTA
TGATTATTAATTAAACATTACAACTAGGATGATGGCGCTTAAGAATGAAC
GGAAGAAAGAAAACTTGGCAAAGCTTTAAACAATTTAATTTTCCTTTAAC
GCTTGAAATTACACTGAAGCATATATTTTTGTTTTCCTAATTTTAGTTTT
GTTTTGGTTTAAACAACGCAAGAAAAAATGTTACTAATGCAAAGCAAACA
GAGATCAGCAATAAAAAAAAATTATAAAAATGCACAGGCACCAAACTGGA
ATTACGTTGAATCACCGTTTCCTGCATTACGATTATATGATTTCAATCCA
AATGATTTTCCTATTAATTTTAATCAATGAAGAGTTTTCCTATTATTGAT
TAGCCACAGCCAATAAACAACAAGAACAACCAACTCAGCAGCACACACAC
ATTCAAATTCATTAATTTATATCGAGAGAGTACGTTTAGAGTTTAAGTTC
GAGAAAGTTCATTTCCAGGCACTAATTTTCACTCACACCACTCACATAGA
AAAACACAAACACCTCATTTTGTAGTTTTCCGAGTCCCTTGGATCGTTTT
CCTCTTTTTTAATCGAAATAACGCATAATGCATAATAATTATTACCAGAT
ATACACTAAAACCTATAAATATATATTAATATATGTTCTGTGATCTGTAG
CATACCTTGTACAAAGTGTTTTTTTTAGCATAATTATGCGATTTTAATTA
TGATCCGCAATCGAAATTACACATTTTTGTTCTCATTTCGATGGTAAAAA
CACTCTATCATGATGTAAAAAAAAAAAACAAAAGAAAACATTTGATGATG
TTGCGAAAAAATATATTATCTAAAACATAAAGAAAAACAAACACTAGCTC
TTAATAAATTGCAAAAATTTAAAAAACAAAAAAAAAAAAAAAAAAA

LD10532.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 2319 emc-RA 87..2121 1..2035 10130 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 752023..753242 806..2027 5885 99.1 Plus
chr3L 24539361 chr3L 749182..749987 1..806 3970 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 600 CG1007-PA 1..600 243..842 3000 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:57:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 2049 CG1007-RA 23..2049 1..2027 10120 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
emc-PA 199 CG1007-PA 1..199 243..839 773 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 752271..753500 806..2035 6105 99.8 Plus
3L 28110227 3L 749422..750227 1..806 4030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 752271..753500 806..2035 6105 99.7 Plus
3L 28103327 3L 749422..750227 1..806 4030 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:27:55 has no hits.

LD10532.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:16:48 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 752023..753242 806..2027 95   Plus
chr3L 749182..749902 1..721 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:44:05 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 243..842 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:51 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 243..842 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:13:45 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 243..842 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:39:40 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 243..842 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:48 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 243..842 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:10:44 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 17..2043 1..2027 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:51 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 17..2043 1..2027 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:13:45 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 23..2049 1..2027 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:39:40 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 17..2043 1..2027 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:48 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 23..2049 1..2027 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:16:48 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
3L 752272..753492 807..2027 99   Plus
3L 749422..750227 1..806 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:13:45 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 752272..753492 807..2027 99   Plus
arm_3L 749422..750227 1..806 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:22:41 Download gff for LD10532.complete
Subject Subject Range Query Range Percent Splice Strand
3L 752272..753492 807..2027 99   Plus
3L 749422..750227 1..806 100 -> Plus

LD10532.pep Sequence

Translation from 242 to 841

> LD10532.pep
MKSLTAVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLV
PFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGL
HEDEDSDMEDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQT
PNTLVAPAHPQQHQQQQQLQLQQQQLQSQQQLSNSLATPQNAEKDSRQS*

LD10532.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10395-PA 196 GF10395-PA 1..196 1..199 666 84.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14734-PA 201 GG14734-PA 1..201 1..199 816 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15419-PA 219 GH15419-PA 1..219 1..199 505 58.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
emc-PA 199 CG1007-PA 1..199 1..199 1017 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13022-PA 201 GI13022-PA 1..201 1..199 547 65.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20711-PA 193 GL20711-PA 1..193 1..199 627 73 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10048-PA 193 GA10048-PA 1..193 1..199 627 73 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14354-PA 199 GM14354-PA 1..199 1..199 829 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13571-PA 199 GD13571-PA 1..199 1..199 1033 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12114-PA 206 GJ12114-PA 1..206 1..199 544 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17519-PA 236 GK17519-PA 1..168 1..155 499 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\emc-PA 199 GE21098-PA 1..199 1..199 1027 98.5 Plus

LD10532.hyp Sequence

Translation from 242 to 841

> LD10532.hyp
MKSLTAVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLV
PFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGL
HEDEDSDMEDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQT
PNTLVAPAHPQQHQQQQQLQLQQQQLQSQQQLSNSLATPQNAEKDSRQS*

LD10532.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
emc-PA 199 CG1007-PA 1..199 1..199 1017 100 Plus