Clone LD10588 Report

Search the DGRC for LD10588

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:105
Well:88
Vector:pBS SK-
Associated Gene/TranscriptCG2135-RA
Protein status:LD10588.pep: gold
Preliminary Size:2337
Sequenced Size:2321

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2135 2001-01-01 Release 2 assignment
CG2135 2003-01-01 Sim4 clustering to Release 3
CG2135 2003-04-25 Blastp of sequenced clone
CG2135 2008-04-29 Release 5.5 accounting
CG2135 2008-08-15 Release 5.9 accounting
CG2135 2008-12-18 5.12 accounting

Clone Sequence Records

LD10588.complete Sequence

2321 bp (2321 high quality bases) assembled on 2003-04-25

GenBank Submission: BT010073

> LD10588.complete
AGATGGTTCACAAATGTTTGATAACCATTAAATTGTAACTCGATAGAAAT
ATTCTGATTTCAGATGAAAAGTCATTGGATGCCCGTCACCTGCTTACTGC
TTGGCAGTCTCCAGGTTCTATTGGCTTACACCGAAAACGACTTCTTGGTG
AACGCCAATCGCAAAGAACTAACTGATTCCCCTTTGTTTGAATATGATAA
TGTCAGAAAGCCCACACCAACCAAGGGATTGTTGTACCCCAGGGATTCGG
AGACCCGTGAAGTGCGGAGCTTGGATGGAATGTGGCAACTGGTTAGGAGT
GATCCATATGACCCCTTACAGGGAATTAGGGAAAAGTGGTTTATGGATGC
CTTGAGAAAAACCGGAAGGGAGATTATTTCGATGCCAGTGCCTGCCTCCT
ATAACGACATCACTACAGATAACTTACGAGATCACGTTGGAACCGTATGG
TATGAGCGTACTTTTTTTGTGCCGCGCTCCTGGAAGACTATGCAACGCAC
TTGGTTGCGATTTAGCAGCGTTCACTATTCGGCCGTGGTATGGATCAACG
GAAGGAACGCCACAAGTCACTCCATTGGCCACCTACCCTTTGAGTCAGAG
ATCTCGGGACTGCTCAGCTTTGGCGGCGATAACAGGATCACGGTGATGTG
TGACAATCGTTTGAGCAACCGCACCATTCCTCAGGGTTCTGTTTACAAGG
TGGCTACGGATGACGGCACCGTGCCCATCCAGAGTTACACTTTCGATTTT
TTTAACTACGCGGGAATCCACCGGAGTGTACACTTGTACACGACCCCGCT
GCTGCACATAAGCGATTTGGAGGTCACCACCCAACTAACTAAAGAAGGAT
TGGGCCGCATAGACTACCGCGTGTGGTTGGATGCTAGCAAGGAGGGCCTC
CAAATCCAGCCCATCCAACTTCGGGTGCAACTAAGGGACAAAGATGGTCA
TGTGGCCGCCCAGCAGATCAACAAGGCGGTCTACCATGGTACTCTGCTGG
TGCCAAATGCAACTCCCTGGTGGCCCTACCTAATGCATTCCGATCCCGGC
TACCTGTATAATCTTCAATTCGAGCTGTTTGTGGCCAGCAATGAGAAGGA
GTTGGAATCTCTGCAGGATACCTACCGCCTCCCAGTGGGCATACGTAGCT
TAAGTTGGGACAACGACAGCCTGCTGCTGAATGGAAAACCCCTCTATCTG
CGGGGATTTGGACGGCACGAGGACTCCGATATCCGCGGGAAGGGATTGGA
TAATGCGCTTCTTGCTAGAGATTTTAACCTGCTGAAGTGGACTGGAGCCA
ATGCATATCGCACCTCTCACTATCCTTATTCCGAAGAGTCAATGCAGTTT
GCCGATCAGCATGGTATTATGATTATTGACGAATGCCCTGCTGTCAATAT
AGATATCTTCGAGCCGCAGCTACTGGAGAATCACATGTCCTCGCTGGAGC
AACTGATCCACCGGGACAGAAACCATCCAAGTGTTGTTGCATGGTCGGTA
GCCAACGAGCCGAGATCGAACAAGCAGGGAGCCCTTAAATACTTTGAATT
CCTGGTAAACTATGTAAGAGAAATAGCTCACGGACGACCTCTAACCGCGG
CTATAAATGCCAACTCTTCCAGTTGCCATTTGGCGCAGTTTCTGGACATC
GTGGGTTTCAATCGCTATAACTCTTGGTATCAGAACTCGGGCCGTACTGA
CATGATACTTAACCTGTTGACGATAGAGGCCCAGAGTTGGCGGGATAGGT
TCGGAAAGCCTGTCATCCAATTTGAGTACGGCGGCGACACTATGGAGGGC
ATGCACTCACTTCCCGCCTTTATTTGGTCGGAGGAATACCAGGTTGAGCT
CTTCTCTCGCCATTTCAAGGCTTTCGACGAGTTACGCGGAAGAGGATGGT
TTATTGGAGAGTTTGTTTGGAACTTCGCCGATTTTCGGACCGCGCAGACT
ATTACCCGCGTGGGCGGCAACAAAAAGGGAGTCTTTACAAGGAACCGACA
ACCCAAAGAAGTGGCTCACATTCTTAGGCGGCGGTACTTCGCATTAGCCA
AGGAGTTGGATATGTTTGGGCTGCCTGAGGATCTCACTGTTTACATTTCC
AAGCATATCCATAACGAGCTTTGAATCAGGGATACGTACAGCCAGAGTCT
CATGACCAAGAGACCGTATTTGTATGTTATAAAGGTGCGAGTTATTCACT
ACGCATTACATTAAGCTTTATTCAAATTTTTCAGCAATGGTCTGTGGAAT
AATTTTTTTTTTAAATATGTATTATCTTTTCTTATTAAATCATGATTCCT
AATAAAAAAAAAAAAAAAAAA

LD10588.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-RA 2347 CG2135-RA 44..2347 1..2303 11480 99.9 Plus
CG15117.a 2199 CG15117.a 1137..1252 1270..1385 280 82.7 Plus
CG15117.b 2199 CG15117.b 1137..1252 1270..1385 280 82.7 Plus
CG15117.a 2199 CG15117.a 1692..1846 1825..1979 205 75.4 Plus
CG15117.b 2199 CG15117.b 1692..1846 1825..1979 205 75.4 Plus
CG15117.a 2199 CG15117.a 897..940 1015..1058 160 90.9 Plus
CG15117.b 2199 CG15117.b 897..940 1015..1058 160 90.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27592950..27594179 1230..1 6135 99.9 Minus
chr3R 27901430 chr3R 27591651..27592006 2303..1949 1730 99.7 Minus
chr3R 27901430 chr3R 27592576..27592892 1547..1231 1585 100 Minus
chr3R 27901430 chr3R 27592259..27592520 1809..1548 1310 100 Minus
chr3R 27901430 chr3R 27592066..27592204 1948..1810 695 100 Minus
chr2R 21145070 chr2R 15010643..15010821 1385..1207 325 78.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-RA 2061 CG2135-PA 1..2061 64..2124 10305 100 Plus
CG15117-RF 1872 CG15117-PF 964..1241 1207..1484 385 75.9 Plus
CG15117-RE 1872 CG15117-PE 964..1241 1207..1484 385 75.9 Plus
CG15117-RF 1872 CG15117-PF 1582..1736 1825..1979 205 75.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
pncr017:3R-RA 1404 CR33945-RA 1262..1404 2304..2163 675 99.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-RA 2331 CG2135-RA 28..2331 1..2303 11470 100 Plus
CG15117-RF 2707 CG15117-RF 1583..1860 1207..1484 385 75.9 Plus
CG15117-RE 2380 CG15117-RE 1256..1533 1207..1484 385 75.9 Plus
CG15117-RF 2707 CG15117-RF 2201..2355 1825..1979 205 75.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-PA 686 CG2135-PA 1..686 64..2121 3594 100 Plus
CG15117-PD 648 CG15117-PD 16..644 202..2100 2084 61.7 Plus
CG15117-PC 656 CG15117-PC 24..652 202..2100 2084 61.7 Plus
CG15117-PA 656 CG15117-PA 24..652 202..2100 2084 61.7 Plus
CG15117-PB 670 CG15117-PB 38..666 202..2100 2084 61.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31770592..31771821 1230..1 6150 100 Minus
3R 32079331 3R 31769292..31769648 2304..1949 1735 99.7 Minus
3R 32079331 3R 31770218..31770534 1547..1231 1585 100 Minus
3R 32079331 3R 31769901..31770162 1809..1548 1310 100 Minus
3R 32079331 3R 31769708..31769846 1948..1810 695 100 Minus
2R 25286936 2R 19123517..19123695 1385..1207 325 78.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31511423..31512652 1230..1 6150 100 Minus
3R 31820162 3R 31510123..31510479 2304..1949 1745 99.7 Minus
3R 31820162 3R 31511049..31511365 1547..1231 1585 100 Minus
3R 31820162 3R 31510732..31510993 1809..1548 1310 100 Minus
3R 31820162 3R 31510539..31510677 1948..1810 695 100 Minus
2R 25260384 2R 19124716..19124831 1385..1270 280 82.7 Minus
2R 25260384 2R 19123884..19123994 1935..1825 165 76.5 Minus
2R 25260384 2R 19125028..19125071 1058..1015 160 90.9 Minus
Blast to na_te.dros performed on 2014-11-27 07:57:22 has no hits.

LD10588.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:53:47 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27592950..27594179 1..1230 99   Minus
chr3R 27592576..27592892 1231..1547 100 <- Minus
chr3R 27592259..27592520 1548..1809 100 <- Minus
chr3R 27592066..27592204 1810..1948 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:44:09 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 1..2061 64..2124 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:52 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 1..2061 64..2124 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:57:39 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 1..2061 64..2124 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:20 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 1..2061 64..2124 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:47 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 1..2061 64..2124 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:57:24 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
pncr017:3R-RA 1263..1404 2163..2303 99   Minus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:55:39 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 33..2336 1..2303 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:52 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 33..2336 1..2303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:57:39 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 28..2331 1..2303 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:20 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 33..2336 1..2303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:47 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 28..2331 1..2303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:53:47 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31770592..31771821 1..1230 100   Minus
3R 31770218..31770534 1231..1547 100 <- Minus
3R 31769901..31770162 1548..1809 100 <- Minus
3R 31769708..31769846 1810..1948 100 <- Minus
3R 31769293..31769648 1949..2303 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:57:39 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27596314..27597543 1..1230 100   Minus
arm_3R 27595940..27596256 1231..1547 100 <- Minus
arm_3R 27595623..27595884 1548..1809 100 <- Minus
arm_3R 27595430..27595568 1810..1948 100 <- Minus
arm_3R 27595015..27595370 1949..2303 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:20 Download gff for LD10588.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31511423..31512652 1..1230 100   Minus
3R 31511049..31511365 1231..1547 100 <- Minus
3R 31510732..31510993 1548..1809 100 <- Minus
3R 31510539..31510677 1810..1948 100 <- Minus
3R 31510124..31510479 1949..2303 99 <- Minus

LD10588.pep Sequence

Translation from 63 to 2123

> LD10588.pep
MKSHWMPVTCLLLGSLQVLLAYTENDFLVNANRKELTDSPLFEYDNVRKP
TPTKGLLYPRDSETREVRSLDGMWQLVRSDPYDPLQGIREKWFMDALRKT
GREIISMPVPASYNDITTDNLRDHVGTVWYERTFFVPRSWKTMQRTWLRF
SSVHYSAVVWINGRNATSHSIGHLPFESEISGLLSFGGDNRITVMCDNRL
SNRTIPQGSVYKVATDDGTVPIQSYTFDFFNYAGIHRSVHLYTTPLLHIS
DLEVTTQLTKEGLGRIDYRVWLDASKEGLQIQPIQLRVQLRDKDGHVAAQ
QINKAVYHGTLLVPNATPWWPYLMHSDPGYLYNLQFELFVASNEKELESL
QDTYRLPVGIRSLSWDNDSLLLNGKPLYLRGFGRHEDSDIRGKGLDNALL
ARDFNLLKWTGANAYRTSHYPYSEESMQFADQHGIMIIDECPAVNIDIFE
PQLLENHMSSLEQLIHRDRNHPSVVAWSVANEPRSNKQGALKYFEFLVNY
VREIAHGRPLTAAINANSSSCHLAQFLDIVGFNRYNSWYQNSGRTDMILN
LLTIEAQSWRDRFGKPVIQFEYGGDTMEGMHSLPAFIWSEEYQVELFSRH
FKAFDELRGRGWFIGEFVWNFADFRTAQTITRVGGNKKGVFTRNRQPKEV
AHILRRRYFALAKELDMFGLPEDLTVYISKHIHNEL*

LD10588.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 12:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11493-PA 685 GF11493-PA 33..685 37..686 2894 80.6 Plus
Dana\GF11492-PA 670 GF11492-PA 45..667 53..680 2116 60.7 Plus
Dana\GF11494-PA 472 GF11494-PA 1..356 76..459 884 47.2 Plus
Dana\GF11494-PA 472 GF11494-PA 351..445 577..671 324 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 12:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11851-PA 686 GG11851-PA 1..686 1..686 3279 89.1 Plus
Dere\GG20922-PA 670 GG20922-PA 38..669 47..682 2132 60.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 12:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22628-PA 699 GH22628-PA 56..695 42..678 2348 67.7 Plus
Dgri\GH22627-PA 680 GH22627-PA 45..667 53..679 2095 59.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-PA 686 CG2135-PA 1..686 1..686 3669 100 Plus
CG15117-PD 648 CG15117-PD 16..644 47..679 2130 61.7 Plus
CG15117-PC 656 CG15117-PC 24..652 47..679 2130 61.7 Plus
CG15117-PA 656 CG15117-PA 24..652 47..679 2130 61.7 Plus
CG15117-PB 670 CG15117-PB 38..666 47..679 2130 61.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 12:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20627-PA 690 GI20627-PA 18..685 8..678 2267 62.3 Plus
Dmoj\GI20626-PA 681 GI20626-PA 45..666 53..678 2131 61.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 12:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11761-PA 691 GL11761-PA 37..683 40..681 2656 75.6 Plus
Dper\GL11760-PA 675 GL11760-PA 38..666 47..679 2098 59.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 12:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24063-PA 691 GA24063-PA 37..683 40..681 2657 75.6 Plus
Dpse\GA13505-PA 675 GA13505-PA 38..666 47..679 2098 59.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 12:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16415-PA 686 GM16415-PA 1..686 1..686 3493 95 Plus
Dsec\GM19850-PA 419 GM19850-PA 4..418 263..682 1370 59.3 Plus
Dsec\GM19849-PA 242 GM19849-PA 38..239 47..248 647 59.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 12:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25338-PA 670 GD25338-PA 38..669 47..682 2138 61 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 12:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19670-PA 685 GJ19670-PA 5..681 9..678 2355 64.8 Plus
Dvir\GJ19669-PA 680 GJ19669-PA 45..667 53..679 2111 60.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 12:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17842-PA 680 GK17842-PA 30..668 35..677 2350 66 Plus
Dwil\GK17841-PA 681 GK17841-PA 46..669 53..680 2091 60.3 Plus
Dwil\GK17843-PA 611 GK17843-PA 8..611 49..686 1640 50.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 12:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23298-PA 688 GE23298-PA 23..688 21..686 3293 91.3 Plus
Dyak\GE13860-PA 670 GE13860-PA 38..669 47..682 2144 60.8 Plus

LD10588.hyp Sequence

Translation from 63 to 2123

> LD10588.hyp
MKSHWMPVTCLLLGSLQVLLAYTENDFLVNANRKELTDSPLFEYDNVRKP
TPTKGLLYPRDSETREVRSLDGMWQLVRSDPYDPLQGIREKWFMDALRKT
GREIISMPVPASYNDITTDNLRDHVGTVWYERTFFVPRSWKTMQRTWLRF
SSVHYSAVVWINGRNATSHSIGHLPFESEISGLLSFGGDNRITVMCDNRL
SNRTIPQGSVYKVATDDGTVPIQSYTFDFFNYAGIHRSVHLYTTPLLHIS
DLEVTTQLTKEGLGRIDYRVWLDASKEGLQIQPIQLRVQLRDKDGHVAAQ
QINKAVYHGTLLVPNATPWWPYLMHSDPGYLYNLQFELFVASNEKELESL
QDTYRLPVGIRSLSWDNDSLLLNGKPLYLRGFGRHEDSDIRGKGLDNALL
ARDFNLLKWTGANAYRTSHYPYSEESMQFADQHGIMIIDECPAVNIDIFE
PQLLENHMSSLEQLIHRDRNHPSVVAWSVANEPRSNKQGALKYFEFLVNY
VREIAHGRPLTAAINANSSSCHLAQFLDIVGFNRYNSWYQNSGRTDMILN
LLTIEAQSWRDRFGKPVIQFEYGGDTMEGMHSLPAFIWSEEYQVELFSRH
FKAFDELRGRGWFIGEFVWNFADFRTAQTITRVGGNKKGVFTRNRQPKEV
AHILRRRYFALAKELDMFGLPEDLTVYISKHIHNEL*

LD10588.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-PA 686 CG2135-PA 1..686 1..686 3669 100 Plus
CG15117-PD 648 CG15117-PD 16..644 47..679 2130 61.7 Plus
CG15117-PC 656 CG15117-PC 24..652 47..679 2130 61.7 Plus
CG15117-PA 656 CG15117-PA 24..652 47..679 2130 61.7 Plus
CG15117-PB 670 CG15117-PB 38..666 47..679 2130 61.7 Plus