Clone LD13018 Report

Search the DGRC for LD13018

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:130
Well:18
Vector:pBS SK-
Associated Gene/TranscriptKlc-RA
Protein status:LD13018.pep: gold
Preliminary Size:1870
Sequenced Size:1830

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5433 2001-01-01 Release 2 assignment
CG5433 2001-10-10 Blastp of sequenced clone
CG5433 2003-01-01 Sim4 clustering to Release 3
Klc 2008-04-29 Release 5.5 accounting
Klc 2008-08-15 Release 5.9 accounting
Klc 2008-12-18 5.12 accounting

Clone Sequence Records

LD13018.complete Sequence

1830 bp (1830 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061164

> LD13018.complete
ATTTTTATAGCAAATCTACGCACTATTTCGCTTATTTGAGGAGTTTGCAG
AGCAAAACCGCTGACAGAAAATTGAGAAAATCGGCAAAATGACGCAAATG
TCGCAGGACGAAATCATAACCAATACGAAAACAGTCCTTCAAGGCCTCGA
AGCCTTGCGAGTGGAGCATGTTTCGATTATGAACGGAATCGCCGAGGTGC
AGAAGGACAATGAAAAGTCGGACATGCTGCGAAAGAACATCGAGAACATC
GAACTGGGCCTCAGCGAGGCCCAGGTGATGATGGCCCTGACATCCCATCT
GCAGAACATCGAGGCCGAGAAGCACAAGCTTAAGACACAGGTGCGCCGCC
TCCACCAGGAGAACGCCTGGCTTCGCGACGAGCTGGCCAACACTCAGCAA
AAGTTCCAGGCATCCGAGCAGCTGGTGGCCCAACTAGAGGAGGAGAAGAA
GCACCTGGAGTTCATGGCGTCCGTGAAGAAGTACGACGAGAATCAGGAGC
AGGACGACGCTTGCGACAAGTCCCGCACCGATCCCGTGGTCGAGCTATTC
CCGGACGAGGAAAACGAGGACAGACACAACATGTCGCCCACTCCGCCCAG
CCAGTTCGCCAACCAGACTTCCGGCTACGAGATTCCAGCGCGTCTCCGTA
CTCTGCACAACCTGGTCATTCAGTATGCATCGCAGGGAAGATACGAGGTA
GCCGTTCCCCTCTGCAAGCAAGCATTGGAAGATCTCGAAAGGACAAGTGG
TCACGACCATCCCGATGTAGCAACCATGCTGAACATTTTGGCTCTCGTGT
ACCGCGATCAGAACAAGTATAAGGAGGCCGCCAATTTACTCAACGACGCT
CTGTCGATTCGAGGAAAGACACTGGGCGAGAACCATCCAGCCGTGGCGGC
CACGTTGAACAACTTGGCCGTCCTCTATGGCAAACGTGGCAAGTACAAAG
ATGCCGAGCCACTGTGCAAGCGTGCCTTGGAGATCCGAGAGAAAGTCCTG
GGAAAGGATCATCCCGATGTTGCCAAGCAACTTAACAATCTCGCCCTGCT
CTGCCAGAATCAGGGCAAATACGACGAGGTTGAGAAGTACTACCAGCGAG
CTCTCGACATCTACGAATCAAAGTTGGGTCCCGATGATCCCAACGTGGCC
AAGACAAAGAATAATCTGGCCGGCTGCTATCTGAAGCAAGGTAGATACAC
CGAAGCTGAAATCCTCTATAAGCAGGTCTTGACGCGAGCCCACGAACGTG
AGTTTGGAGCCATCGACAGCAAAAACAAGCCCATTTGGCAGGTGGCTGAG
GAGCGTGAGGAGCACAAATTCGATAACAGGGAGAACACTCCATATGGCGA
GTACGGCGGTTGGCATAAGGCCGCTAAAGTGGATTCGCCCACGGTCACAA
CCACTCTAAAAAATCTGGGAGCACTTTACCGACGTCAAGGCATGTTTGAA
GCGGCCGAAACCCTGGAAGACTGTGCAATGCGGAGTAAAAAAGAAGCCTA
CGATCTAGCTAAACAAACGAAGCTCTCACAATTGCTAACGTCAAACGAAA
AGCGACGATCGAAGGCAATTAAAGAGGATTTGGATTTCTCTGAGGAGAAG
AATGCGAAACCATAAAAATATTATTTGTTCATCGCCCACAACGGAATCTT
TAAGTTTATGATTGAAAGCTAACAGCAAACACACACTTTATTTATTCATT
CCTTAATATACATAAGCTCTCAAGCATACATTAGCAAATAAACAACGTTT
TATACCTTGTTATTTCAAAAAATATGTACCGCTTTTAATAATAAACCAAA
TATATTTAACATAAAAAAAAAAAAAAAAAA

LD13018.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RA 1885 Klc-RA 74..1885 1..1812 9060 100 Plus
Klc.c 1798 Klc.c 46..1797 63..1814 8760 100 Plus
Klc.d 1883 Klc.d 132..1882 64..1814 8755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12738452..12739079 690..63 3125 99.8 Minus
chr3L 24539361 chr3L 12737669..12738153 1293..809 2395 99.6 Minus
chr3L 24539361 chr3L 12737294..12737602 1597..1289 1545 100 Minus
chr3L 24539361 chr3L 12737012..12737228 1812..1596 1085 100 Minus
chr3L 24539361 chr3L 12738217..12738339 811..689 615 100 Minus
chr3L 24539361 chr3L 12740338..12740400 63..1 315 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RB 1527 CG5433-PB 1..1527 89..1615 7635 100 Plus
Klc-RA 1527 CG5433-PA 1..1527 89..1615 7635 100 Plus
Klc-RC 1524 CG5433-PC 1..1511 89..1599 7555 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RA 1843 CG5433-RA 32..1843 1..1812 9060 100 Plus
Klc-RB 1841 CG5433-RB 93..1841 64..1812 8745 100 Plus
Klc-RC 1876 CG5433-RC 131..1876 64..1812 8665 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-PB 508 CG5433-PB 1..508 89..1612 2484 100 Plus
Klc-PA 508 CG5433-PA 1..508 89..1612 2484 100 Plus
Klc-PC 507 CG5433-PC 1..507 89..1612 2467 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12748056..12748683 690..63 3140 100 Minus
3L 28110227 3L 12747273..12747757 1293..809 2425 100 Minus
3L 28110227 3L 12746898..12747206 1597..1289 1545 100 Minus
3L 28110227 3L 12746614..12746832 1814..1596 1095 100 Minus
3L 28110227 3L 12747821..12747943 811..689 615 100 Minus
3L 28110227 3L 12749963..12750025 63..1 315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12741156..12741783 690..63 3140 100 Minus
3L 28103327 3L 12740373..12740857 1293..809 2425 100 Minus
3L 28103327 3L 12739998..12740306 1597..1289 1545 100 Minus
3L 28103327 3L 12739714..12739932 1814..1596 1095 100 Minus
3L 28103327 3L 12740921..12741043 811..689 615 100 Minus
3L 28103327 3L 12743063..12743125 63..1 315 100 Minus
Blast to na_te.dros performed on 2014-11-27 11:02:45 has no hits.

LD13018.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:55:10 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12740338..12740400 1..63 100   Minus
chr3L 12738452..12739078 64..690 99 <- Minus
chr3L 12738217..12738337 691..811 100 <- Minus
chr3L 12737671..12738150 812..1291 99 <- Minus
chr3L 12737294..12737599 1292..1597 100 <- Minus
chr3L 12737012..12737226 1598..1812 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:47:03 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 89..1615 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:41:22 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 89..1615 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:08 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 89..1615 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:10:20 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 89..1615 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:10 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 89..1615 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:23:18 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 32..1843 1..1812 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:41:22 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 32..1843 1..1812 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:08 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 32..1843 1..1812 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:10:21 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 32..1843 1..1812 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:10 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 32..1843 1..1812 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:55:10 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12749963..12750025 1..63 100   Minus
3L 12748056..12748682 64..690 100 <- Minus
3L 12747821..12747941 691..811 100 <- Minus
3L 12747275..12747754 812..1291 100 <- Minus
3L 12746898..12747203 1292..1597 100 <- Minus
3L 12746616..12746830 1598..1812 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:08 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12743063..12743125 1..63 100   Minus
arm_3L 12741156..12741782 64..690 100 <- Minus
arm_3L 12740921..12741041 691..811 100 <- Minus
arm_3L 12740375..12740854 812..1291 100 <- Minus
arm_3L 12739998..12740303 1292..1597 100 <- Minus
arm_3L 12739716..12739930 1598..1812 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:46:31 Download gff for LD13018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12743063..12743125 1..63 100   Minus
3L 12741156..12741782 64..690 100 <- Minus
3L 12740921..12741041 691..811 100 <- Minus
3L 12740375..12740854 812..1291 100 <- Minus
3L 12739998..12740303 1292..1597 100 <- Minus
3L 12739716..12739930 1598..1812 100 <- Minus

LD13018.pep Sequence

Translation from 88 to 1614

> LD13018.pep
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKN
IENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELA
NTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPV
VELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQG
RYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANL
LNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDD
PNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIW
QVAEEREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQ
GMFEAAETLEDCAMRSKKEAYDLAKQTKLSQLLTSNEKRRSKAIKEDLDF
SEEKNAKP*

LD13018.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10870-PA 508 GF10870-PA 1..508 1..508 2670 97.4 Plus
Dana\GF19976-PA 909 GF19976-PA 433..626 186..379 223 28.9 Plus
Dana\GF19976-PA 909 GF19976-PA 404..586 199..381 202 28.4 Plus
Dana\GF19976-PA 909 GF19976-PA 343..546 176..383 199 26.4 Plus
Dana\GF19976-PA 909 GF19976-PA 475..642 186..353 177 29.6 Plus
Dana\GF19976-PA 909 GF19976-PA 507..680 176..345 174 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13809-PA 508 GG13809-PA 1..508 1..508 2715 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16833-PA 508 GH16833-PA 1..508 1..508 2600 94.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-PB 508 CG5433-PB 1..508 1..508 2623 100 Plus
Klc-PA 508 CG5433-PA 1..508 1..508 2623 100 Plus
Klc-PC 507 CG5433-PC 1..507 1..508 2606 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11926-PA 507 GI11926-PA 1..507 1..508 2593 94.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24935-PA 508 GL24935-PA 1..508 1..508 2669 97.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18878-PA 508 GA18878-PA 1..508 1..508 2669 97.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24634-PA 498 GM24634-PA 1..498 1..508 2648 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12703-PA 634 GD12703-PA 1..424 1..424 2285 100 Plus
Dsim\GD12703-PA 634 GD12703-PA 544..634 418..508 474 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13801-PA 507 GJ13801-PA 1..507 1..508 2589 94.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20263-PA 507 GK20263-PA 1..504 1..503 2583 95.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20101-PA 508 GE20101-PA 1..508 1..508 2715 99.2 Plus

LD13018.hyp Sequence

Translation from 88 to 1614

> LD13018.hyp
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKN
IENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELA
NTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPV
VELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQG
RYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANL
LNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDD
PNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIW
QVAEEREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQ
GMFEAAETLEDCAMRSKKEAYDLAKQTKLSQLLTSNEKRRSKAIKEDLDF
SEEKNAKP*

LD13018.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-PB 508 CG5433-PB 1..508 1..508 2623 100 Plus
Klc-PA 508 CG5433-PA 1..508 1..508 2623 100 Plus
Klc-PC 507 CG5433-PC 1..507 1..508 2606 99.8 Plus