Clone LD13366 Report

Search the DGRC for LD13366

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:133
Well:66
Vector:pBS SK-
Associated Gene/TranscriptStrica-RA
Protein status:LD13366.pep: gold
Preliminary Size:2177
Sequenced Size:2243

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7863 2001-01-01 Release 2 assignment
CG7863 2003-01-01 Sim4 clustering to Release 3
dream 2008-04-29 Release 5.5 accounting
dream 2008-08-15 Release 5.9 accounting
dream 2008-12-18 5.12 accounting

Clone Sequence Records

LD13366.complete Sequence

2243 bp (2243 high quality bases) assembled on 2006-01-17

GenBank Submission: BT024233

> LD13366.complete
GCTTGCGATGAGTAAGCCTCCTTATCTTGGGAGCGTTTTTATTCTGAATT
CTCTCCGAGTCTTTCAGTTCAGCGAGAACCGTCGAGCTTCACAAAGCAAC
TACAGCGCAGTGCGTGAAAGCCAGTTTAAGACAGAAAGCTCAACACACGC
AAACCGGAGTCATTATGGGTTGGTGGAGCAAGAAAAGCGAGACGGATCGC
AGTCAGCCCAGCCAGGAACTGGTGGCGCAGGACCCGCGCACACGAGTCCA
GACTACGAGTGCAGCCACGGAGACGACCAACACAGCCGTGCAAAACTCGA
CCATAACGGACAACAACAAGCAGACGGTTACCTTTCTCACCACCCGCCAG
ACGGTGACGCACACGCAGCGGGCGCTGATCACGGAGACGACAACGCGACG
CACGCCTAGTCAGGCGGAGTTAGAGGCTCTCTTCGCAAAGATAAAGATGG
GCGGTGAGGGACCCATTGGCTCCACCACCACCACTACGACGACCACCTCC
TCGCGCTCCCGACCGCCCAGTTTGAACGGCGTCTCCTTTCGCTCCACACA
ACCCTTCAAAGCCACGGCAAGCAATGCTGGCAAACGGTCAAGCACCTTAG
TCAAGACCGAGCAGACGACAGTGACCCAAAAGAATGGGCGCACGGTCACC
CAGCACCTGGAGACTCATAGAGTGGACCTCAAGGGAAGTCGACCTAAGGC
GACCTGGGCGTCATTTGCGTCCACTGCAAACAGCTCAACATCCAGCTACG
TCTCACCTTATCGTCAGAAGCCAAGCATGGCCATAACTTGCACATCTCCC
AACATCAAGACACCAAAAACCACTAGCTCCACGTCCAGTTCCAGTGCCAG
CTCCATTACGAGTCCGCCCAAACCATCATCATCTGTATCCTCCATTTCAA
GCATTTTCAAGTCCGCTCCCAAGCAAGTTGACAAGCCGCTCAGTTCTACC
GCAACTCCCAAGCCCTTCATTAGTCTGGGATCGTCAGGAGGCACCAAGCC
GAAGGTCACTGCCGTCGCGCAATCCCAAGATGCCCAGGGCACGATTTCAA
CGAGCCTGGGTATCTCGAAATCAAGCCTGACCAAGAACAAACTCAAGCCC
GCCCGGGTGTATATCTTCAACCACGAGCGGTTCGATAACAAGAACGAATT
CCGAAAGGGAAGTGCCCAGGATGTGAAGGTCTTGCGCGCCACCTTTGAGC
AGCTGAAGTGCAAAGTGGAAGTTATTACAGATGCAACCCTGGTCACCATT
AAAAAAACAGTGCGAATGTTGCAAACCAAGGACTTTGAGGACAAAAGCGC
TCTGGTCCTCGTGATCCTCAGTCATGGAACGCGCCACGACCAGATCGCAG
CAAAGGATGACGACTACTCCCTGGACGACGACGTTGTTTTTCCCATTTTG
CGCAATAGGACGCTTAAGGACAAGCCCAAGCTGATTTTCGTTCAGGCCTG
CAAGGGCGACTGCCAACTAGGGGGCTTTATGACCGATGCCGCGCAGCCCA
ATGGGTCTCCAAATGAAATCCTCAAGTGCTATAGCACGTACGAGGGATTT
GTATCTTTTCGCACGGAGGACGGAACTCCTTTTATTCAGACACTGTGTGA
AGCTCTTAATCGATCGGGGAAGACTTCAGACATCGACACCATAATGATGA
ATGTGCGTCAAGTGGTTAAAATGCAATCCAAAGACCGCCAAATTCCATCT
GTCACTAGCACTCTTACCTCTAAGTACGTTTTTGGAGATTATATTTGACC
ATAGATCTTAAATCTAAGACACGCCATTAAATATCAAAATTAATATATAT
GTAAATAGCACATGGATAGATGTATGTACATAGTATATAGCACATAGCGT
CTGGTCCACGTAGTGACGAAGCGTACCAGAAGAAGGTGATATATACGAAG
AAATGAAAATTTGCGATGGTTGTCCGATCTTAGCTTAATATAACAATCGA
GAGGTAGCTCACAAACTAAAGAGGCGGTAAAAGTGTGAGGCTAAATATTA
AAAAAAAATTAGTCTGGGGTCGGAATTGTTAAAGGAAAACTATTTTCGGT
AACCAGAACCTGAAAATATGAAAAACTTTTTTTTATTTTGGTCGATTTTT
TAAGAACGGTCATCGCATGTAAAATGTTAAACCGTGTGCCCTTGAAATTT
TTTAACTTTTATTGTACTAAAAATTAACGTTTTAATGTTATTATAAAATA
AAAACAGTTATTTTTTCTCAATACCAAAAAAAAAAAAAAAAAA

LD13366.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
dream.b 2819 dream.b 38..2264 1..2227 11135 100 Plus
dream-RA 2535 dream-RA 310..2535 1..2226 11130 100 Plus
dream.a 2334 dream.a 1..1259 1..1259 6295 100 Plus
dream.a 2334 dream.a 1260..2217 1270..2227 4790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1909123..1910391 1269..1 6300 99.8 Minus
chr2R 21145070 chr2R 1908056..1908596 2225..1682 2625 99.3 Minus
chr2R 21145070 chr2R 1908656..1909067 1681..1270 2060 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-RB 1584 CG7863-PB 1..1584 165..1748 7920 100 Plus
Strica-RA 1584 CG7863-PA 1..1584 165..1748 7920 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-RB 2720 CG7863-RB 1..2163 63..2225 10815 100 Plus
Strica-RA 2163 CG7863-RA 1..2163 63..2225 10815 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-PB 527 CG7863-PB 1..527 165..1745 1942 100 Plus
Strica-PA 527 CG7863-PA 1..527 165..1745 1942 100 Plus
Damm-PB 255 CG18188-PB 34..251 1089..1742 406 44.9 Plus
Damm-PA 255 CG18188-PA 34..251 1089..1742 406 44.9 Plus
Dcp-1-PA 323 CG5370-PA 83..315 1113..1739 221 32.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6021938..6023206 1269..1 6345 100 Minus
2R 25286936 2R 6020866..6021411 2227..1682 2730 100 Minus
2R 25286936 2R 6021471..6021882 1681..1270 2060 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6023137..6024405 1269..1 6345 100 Minus
2R 25260384 2R 6022065..6022610 2227..1682 2730 100 Minus
2R 25260384 2R 6022670..6023081 1681..1270 2060 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:29:18 has no hits.

LD13366.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:24:51 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1909123..1910391 1..1269 99   Minus
chr2R 1908656..1909067 1270..1681 100 <- Minus
chr2R 1908056..1908596 1682..2225 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:47:31 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..1584 165..1748 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:38:30 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..1584 165..1748 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:37 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..1584 165..1748 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:13:33 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..1584 165..1748 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:51 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
Strica-RA 1..1584 165..1748 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:10:27 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..2225 1..2225 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:38:30 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..2225 1..2225 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:37 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..2163 63..2225 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:13:33 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 1..2225 1..2225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:51 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
Strica-RA 1..2163 63..2225 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:24:51 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6021938..6023206 1..1269 100   Minus
2R 6021471..6021882 1270..1681 100 <- Minus
2R 6020868..6021411 1682..2225 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:37 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1909443..1910711 1..1269 100   Minus
arm_2R 1908976..1909387 1270..1681 100 <- Minus
arm_2R 1908373..1908916 1682..2225 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:25 Download gff for LD13366.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6023137..6024405 1..1269 100   Minus
2R 6022670..6023081 1270..1681 100 <- Minus
2R 6022067..6022610 1682..2225 100 <- Minus

LD13366.pep Sequence

Translation from 164 to 1747

> LD13366.pep
MGWWSKKSETDRSQPSQELVAQDPRTRVQTTSAATETTNTAVQNSTITDN
NKQTVTFLTTRQTVTHTQRALITETTTRRTPSQAELEALFAKIKMGGEGP
IGSTTTTTTTTSSRSRPPSLNGVSFRSTQPFKATASNAGKRSSTLVKTEQ
TTVTQKNGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYR
QKPSMAITCTSPNIKTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFKS
APKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGI
SKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCK
VEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDD
YSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPN
EILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQV
VKMQSKDRQIPSVTSTLTSKYVFGDYI*

LD13366.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 01:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13826-PA 525 GF13826-PA 1..525 1..527 1735 72.3 Plus
Dana\GF11805-PA 210 GF11805-PA 3..196 330..524 375 41.2 Plus
Dana\GF13064-PA 326 GF13064-PA 86..318 317..525 266 36.2 Plus
Dana\GF18666-PA 338 GF18666-PA 97..329 317..525 238 33.2 Plus
Dana\GF17937-PA 309 GF17937-PA 60..245 317..482 191 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 01:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10839-PA 531 GG10839-PA 1..531 1..527 2068 82 Plus
Dere\GG22627-PA 249 GG22627-PA 37..246 312..527 432 43.4 Plus
Dere\GG22866-PA 323 GG22866-PA 83..315 317..525 278 35 Plus
Dere\GG16826-PA 308 GG16826-PA 60..247 317..485 193 31.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 01:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22881-PA 538 GH22881-PA 1..538 1..527 1300 54 Plus
Dgri\GH19945-PA 294 GH19945-PA 52..284 317..525 251 33.9 Plus
Dgri\GH21208-PA 318 GH21208-PA 71..312 308..525 248 32.5 Plus
Dgri\GH19956-PA 351 GH19956-PA 109..341 317..525 218 31.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-PB 527 CG7863-PB 1..527 1..527 2663 100 Plus
Strica-PA 527 CG7863-PA 1..527 1..527 2663 100 Plus
Damm-PB 255 CG18188-PB 34..251 309..526 447 45.3 Plus
Damm-PA 255 CG18188-PA 34..251 309..526 447 45.3 Plus
Dcp-1-PA 323 CG5370-PA 83..315 317..525 248 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 01:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21266-PA 556 GI21266-PA 1..556 1..527 1170 49.7 Plus
Dmoj\GI21265-PA 300 GI21265-PA 63..295 266..501 507 43.7 Plus
Dmoj\GI18391-PA 244 GI18391-PA 29..244 330..527 504 47 Plus
Dmoj\GI20496-PA 318 GI20496-PA 70..310 308..525 260 32.6 Plus
Dmoj\GI22043-PA 345 GI22043-PA 104..336 317..525 238 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 01:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17786-PA 511 GL17786-PA 1..511 1..527 1661 68.1 Plus
Dper\GL16870-PA 323 GL16870-PA 8..315 266..525 252 30.3 Plus
Dper\GL23515-PA 344 GL23515-PA 103..335 317..525 229 32.9 Plus
Dper\GL11317-PA 257 GL11317-PA 23..250 317..524 219 32.5 Plus
Dper\GL27295-PA 308 GL27295-PA 60..300 317..521 207 28.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 01:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20641-PA 511 GA20641-PA 1..511 1..527 1699 69.4 Plus
Dpse\GA30275-PA 230 GA30275-PA 35..218 312..497 427 44.4 Plus
Dpse\GA18828-PA 323 GA18828-PA 69..315 303..525 250 33.1 Plus
Dpse\GA24681-PA 261 GA24681-PA 23..254 317..524 247 33.6 Plus
Dpse\GA20588-PA 344 GA20588-PA 103..335 317..525 231 32.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 01:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16490-PA 526 GM16490-PA 1..526 1..527 2244 89.6 Plus
Dsec\GM20405-PA 200 GM20405-PA 34..198 309..477 381 47.7 Plus
Dsec\GM16025-PA 323 GM16025-PA 83..315 317..525 265 34.6 Plus
Dsec\GM12823-PA 343 GM12823-PA 102..334 317..525 241 32.5 Plus
Dsec\GM15423-PA 308 GM15423-PA 60..247 317..485 192 31.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 01:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10341-PA 160 GD10341-PA 1..160 368..527 800 89.4 Plus
Dsim\GD25880-PA 252 GD25880-PA 34..252 309..527 460 44.2 Plus
Dsim\GD11774-PA 323 GD11774-PA 83..315 317..525 265 34.6 Plus
Dsim\GD21467-PA 343 GD21467-PA 102..334 317..525 245 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 01:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20868-PA 534 GJ20868-PA 1..534 1..527 1276 53.4 Plus
Dvir\GJ19552-PA 271 GJ19552-PA 27..264 313..525 260 33.3 Plus
Dvir\GJ22346-PA 314 GJ22346-PA 9..306 270..525 247 31.1 Plus
Dvir\GJ24096-PA 345 GJ24096-PA 104..336 317..525 238 33.3 Plus
Dvir\GJ22849-PA 310 GJ22849-PA 61..302 317..521 178 25.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 01:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17914-PA 525 GK17914-PA 1..525 1..527 1438 58.7 Plus
Dwil\GK17915-PA 299 GK17915-PA 57..293 294..527 726 59.5 Plus
Dwil\GK17888-PA 360 GK17888-PA 164..353 309..502 493 50.8 Plus
Dwil\GK17916-PA 253 GK17916-PA 122..239 310..427 319 51.7 Plus
Dwil\GK23280-PA 330 GK23280-PA 89..322 317..525 251 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 01:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19433-PA 526 GE19433-PA 1..526 1..527 2150 84.8 Plus
Dyak\Damm-PA 251 GE13496-PA 30..248 309..527 443 44.3 Plus
Dyak\GE14302-PA 325 GE14302-PA 85..317 317..525 265 34.2 Plus
Dyak\GE23886-PA 339 GE23886-PA 98..330 317..525 236 32.1 Plus
Dyak\GE26146-PA 308 GE26146-PA 60..247 317..485 188 31.4 Plus

LD13366.hyp Sequence

Translation from 164 to 1747

> LD13366.hyp
MGWWSKKSETDRSQPSQELVAQDPRTRVQTTSAATETTNTAVQNSTITDN
NKQTVTFLTTRQTVTHTQRALITETTTRRTPSQAELEALFAKIKMGGEGP
IGSTTTTTTTTSSRSRPPSLNGVSFRSTQPFKATASNAGKRSSTLVKTEQ
TTVTQKNGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYR
QKPSMAITCTSPNIKTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFKS
APKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGI
SKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCK
VEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDD
YSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPN
EILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQV
VKMQSKDRQIPSVTSTLTSKYVFGDYI*

LD13366.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-PB 527 CG7863-PB 1..527 1..527 2663 100 Plus
Strica-PA 527 CG7863-PA 1..527 1..527 2663 100 Plus
Damm-PB 255 CG18188-PB 34..251 309..526 447 45.3 Plus
Damm-PA 255 CG18188-PA 34..251 309..526 447 45.3 Plus
Dcp-1-PA 323 CG5370-PA 83..315 317..525 248 34.6 Plus