Clone LD13728 Report

Search the DGRC for LD13728

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:137
Well:28
Vector:pBS SK-
Associated Gene/TranscriptCG6254-RA
Protein status:LD13728.pep: gold
Sequenced Size:1981

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6254 2007-03-28 Manual selection by Ken Wan
CG6254 2008-04-29 Release 5.5 accounting
CG6254 2008-08-15 Release 5.9 accounting
CG6254 2008-12-18 5.12 accounting

Clone Sequence Records

LD13728.complete Sequence

1981 bp (1981 high quality bases) assembled on 2006-07-26

GenBank Submission: BT028799

> LD13728.complete
AATATGTCGGATATTCTCGCAGAAACACAAGCCGCGAACAGAGATTCAAC
AATTTGGCACCAATGGTGTCGCCTGTGCTCCAAGGAGCATCCGACAAATC
AAAATGTATTCTTCAGGGAGGCGAAACAAAACTCCTGGGCGAGCACAATG
GCCATGACCATTGGCAAGTACTTTTGGGTCGATATCAAAAGGGAGGACGA
GCTGAGCAATTTTCTGTGCTCCGAATGCTTCACATTGATGGACTGCCTCA
TCGAGTTTTCGGAGAGGGTTCGCAAAGTGCAGATCCTTTTCAGCAAATTG
CAGTTGTTACAGTCTAATAATTTGATGGATTATGAGAAAATTCGAGAGGA
CTGCGGTGTGGCAACCGATGGATGGAAGCATATAATGCTCGGAGCCGTAG
ACGAAAGTCTTCCCCAGAATGACGAAGTATTCATCAGCGAGGAACAACCA
ATAGTCTGCCAAACAGAAACATCCAGTAAAATGAAAAGTGAAATCCTAAT
GATACCAAATTTTTTGGTGGAAAAACAATGTCTTCAGGAAAAACAAGACT
TTCCTAAAGAGGAAGATGTTATTGAAGAAGAAATGCAAATTTCTGGGGTG
GAAGAGGAAATCCTAGAAGAAGATGTGGAAGAAGATCTTGCCGAGGAAGA
GGTTGAAACTGTGGAGGAAGAGATTGACACTGTGGGAGAAGAGGTTGAAG
CTGTGGAGGAAGAGTTGGAAACCCAAGACGCTACAGATTGCTTAGTGGAG
GAAGTGGAGCACATGACAGAGGATCGCTATATCGAGGAGTCGCAGATTAT
AGAAGAAAGCCAAGTTTCAGATTTCAACATGGAAACATATGAAATAGTAC
AACACAATCCGCAAAAAGAACCCGTAGAAACAAAAGACACCGTGGAATCT
ATAGAATCAAACGAGGATACCCAGGAAGATATCTCCCGAGAGCATGTAAC
CGATGAGGAGGATGAAATATCAGAGGTACCAGCCATGTATAAGTGCAATA
TTTGCAAAAAGCCGTATAAGAAACCCAAAGCCTACAAGCGTCACATGGAG
GAGGTTCACAACACTGTGGCCGATGATCTGCCACAGTTGGAGTGCAATCA
GTGCAAACTATGTTTTCCAACAGTCGCCCAACTGCATGCCCACCACCGAA
CCCATGTACGTGCCAAACCAAAGACAGATAACTGCTGTCCACACTGCGAA
AAGCGCTTCACCACCTCGGGAACACTGAAGCGACACATAGAAGGCATCCA
CAACCAAATAAAGCCCTATGTGTGCGACCTCTGTGGCAAAAGCTTCAATT
ACATTACTGGACTGAAGGATCACAAACTTGTGCACACAGATGAGTGCCCC
TTCGAGTGTCCCGTGTGCAAGCGAGGCTTTAAAAACAATGCGAGGTTAAA
GATCCATTTAGATACACACAGTGCCGAAATCTACGAGTGCACTGTATGTG
GCTTGAAGTTAAAAACCCGACGCACATTCAACAAACACAAATTGGTGCAT
TCAGATACACGGCAATTTAAGTGTGAAGTCTGCGGATCGGCGTTCAAGCG
AAGTAAGACACTGAAGGCACATCTCATCCTTCACACCGGCATCCGGCCAT
ATAAGTGCAATTTTTGCGGAAGAGACTTCGCCAATGGCTCCAACTGTCGA
TCGCACAAACGGCAGGCACACCCCAAGGAACTGGCCGAAGAGGAAGCTCG
CGGAGTGACACGATCCACACTTCTTCCAATGCTGGACGAACTGACAATTG
CGTCCAAGCTTTTAAAAACACCCGCAGGTCCTTGCAAAGTAAAGGGTAGT
AGGCCAAAAGCTGCGCCCAAAGATCAAGATAATGGCAATGAATCTCCAAC
GAAGGACACCGATGGTGCCATCCTCTACGAGCTGGTCGAGGAGCTTGATT
ACTCCTAAGTATTTAAATAAACATTAATAAGATACTCACAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD13728.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-RA 2087 CG6254-RA 141..2085 1..1945 9725 100 Plus
Invadolysin.a 2723 Invadolysin.a 2682..2723 1945..1904 210 100 Minus
Invadolysin-RA 3740 Invadolysin-RA 3699..3740 1945..1904 210 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5985560..5986777 1401..184 6075 99.9 Minus
chr3R 27901430 chr3R 5985145..5985498 1753..1400 1755 99.7 Minus
chr3R 27901430 chr3R 5984895..5985082 1939..1752 940 100 Minus
chr3R 27901430 chr3R 5986833..5987015 183..1 915 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-RA 1905 CG6254-PA 1..1905 4..1908 9525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-RA 2006 CG6254-RA 68..2006 1..1939 9695 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-PA 634 CG6254-PA 1..634 4..1905 3017 100 Plus
CG17568-PA 513 CG17568-PA 274..509 1084..1779 620 47.5 Plus
CG10366-PA 578 CG10366-PA 178..539 862..1857 620 37.3 Plus
wek-PB 470 CG4148-PB 270..457 1177..1743 524 51.3 Plus
wek-PA 470 CG4148-PA 270..457 1177..1743 524 51.3 Plus
CG17568-PA 513 CG17568-PA 3..120 43..387 235 40.7 Plus
CG10366-PA 578 CG10366-PA 22..184 46..564 224 35 Plus
CG17568-PA 513 CG17568-PA 359..481 1057..1437 160 32.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10159809..10161026 1401..184 6090 100 Minus
3R 32079331 3R 10159394..10159747 1753..1400 1770 100 Minus
3R 32079331 3R 10159138..10159331 1945..1752 970 100 Minus
3R 32079331 3R 10161082..10161264 183..1 915 100 Minus
3L 28110227 3L 24278324..24278386 1915..1977 210 88.9 Plus
3L 28110227 3L 22809944..22810003 1915..1974 195 88.3 Plus
3L 28110227 3L 23378384..23378443 1915..1974 195 88.3 Plus
3R 32079331 3R 18039009..18039066 1915..1972 185 87.9 Plus
3L 28110227 3L 23386557..23386614 1972..1915 185 87.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9900640..9901857 1401..184 6090 100 Minus
3R 31820162 3R 9900225..9900578 1753..1400 1770 100 Minus
3R 31820162 3R 9899969..9900162 1945..1752 970 100 Minus
3R 31820162 3R 9901913..9902095 183..1 915 100 Minus
3L 28103327 3L 24271424..24271486 1915..1977 210 88.8 Plus
3L 28103327 3L 23371484..23371543 1915..1974 195 88.3 Plus
3L 28103327 3L 22803044..22803103 1915..1974 195 88.3 Plus
Blast to na_te.dros performed on 2014-11-26 19:17:48 has no hits.

LD13728.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:07:06 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5986833..5987015 1..183 100   Minus
chr3R 5985560..5986777 184..1401 99 <- Minus
chr3R 5985147..5985496 1402..1751 99 <- Minus
chr3R 5984895..5985082 1752..1939 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:47:55 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 1..1905 4..1908 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:30 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 1..1905 4..1908 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:40:07 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 1..1905 4..1908 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:51:31 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 1..1905 4..1908 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:07:06 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 1..1905 4..1908 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:00:04 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 65..2003 1..1939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:30 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 65..2003 1..1939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:40:07 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 68..2006 1..1939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:51:31 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 65..2003 1..1939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:07:06 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 68..2006 1..1939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:07:06 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10161082..10161264 1..183 100   Minus
3R 10159809..10161026 184..1401 100 <- Minus
3R 10159396..10159745 1402..1751 100 <- Minus
3R 10159144..10159331 1752..1939 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:40:07 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5986804..5986986 1..183 100   Minus
arm_3R 5985531..5986748 184..1401 100 <- Minus
arm_3R 5985118..5985467 1402..1751 100 <- Minus
arm_3R 5984866..5985053 1752..1939 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:43 Download gff for LD13728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9901913..9902095 1..183 100   Minus
3R 9900640..9901857 184..1401 100 <- Minus
3R 9900227..9900576 1402..1751 100 <- Minus
3R 9899975..9900162 1752..1939 100 <- Minus

LD13728.hyp Sequence

Translation from 0 to 1907

> LD13728.hyp
NMSDILAETQAANRDSTIWHQWCRLCSKEHPTNQNVFFREAKQNSWASTM
AMTIGKYFWVDIKREDELSNFLCSECFTLMDCLIEFSERVRKVQILFSKL
QLLQSNNLMDYEKIREDCGVATDGWKHIMLGAVDESLPQNDEVFISEEQP
IVCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGV
EEEILEEDVEEDLAEEEVETVEEEIDTVGEEVEAVEEELETQDATDCLVE
EVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTVES
IESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHME
EVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCE
KRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECP
FECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVH
SDTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCR
SHKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPCKVKGS
RPKAAPKDQDNGNESPTKDTDGAILYELVEELDYS*

LD13728.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-PA 634 CG6254-PA 1..634 2..635 3394 100 Plus
CG17568-PA 513 CG17568-PA 3..509 15..593 817 33.8 Plus
CG10366-PA 578 CG10366-PA 128..539 213..619 655 34.7 Plus
wek-PB 470 CG4148-PB 270..457 393..581 524 51.3 Plus
wek-PA 470 CG4148-PA 270..457 393..581 524 51.3 Plus

LD13728.pep Sequence

Translation from 3 to 1907

> LD13728.pep
MSDILAETQAANRDSTIWHQWCRLCSKEHPTNQNVFFREAKQNSWASTMA
MTIGKYFWVDIKREDELSNFLCSECFTLMDCLIEFSERVRKVQILFSKLQ
LLQSNNLMDYEKIREDCGVATDGWKHIMLGAVDESLPQNDEVFISEEQPI
VCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGVE
EEILEEDVEEDLAEEEVETVEEEIDTVGEEVEAVEEELETQDATDCLVEE
VEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTVESI
ESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEE
VHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEK
RFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPF
ECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHS
DTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRS
HKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPCKVKGSR
PKAAPKDQDNGNESPTKDTDGAILYELVEELDYS*

LD13728.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17536-PA 547 GF17536-PA 243..547 326..634 1198 70.2 Plus
Dana\GF17497-PA 623 GF17497-PA 2..518 13..585 711 31.7 Plus
Dana\GF14427-PA 579 GF14427-PA 1..523 1..607 678 30.7 Plus
Dana\GF22454-PA 560 GF22454-PA 11..514 22..559 356 25.9 Plus
Dana\GF16427-PA 883 GF16427-PA 315..507 364..556 341 37.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17297-PA 622 GG17297-PA 1..622 1..634 2732 86.6 Plus
Dere\GG21645-PA 514 GG21645-PA 3..512 14..592 760 32.6 Plus
Dere\GG21202-PA 583 GG21202-PA 245..545 329..619 598 40.2 Plus
Dere\GG24194-PA 467 GG24194-PA 255..458 381..585 510 46.3 Plus
Dere\GG12054-PA 872 GG12054-PA 288..493 352..556 346 37.5 Plus
Dere\GG21202-PA 583 GG21202-PA 17..128 11..119 213 39.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22499-PA 569 GH22499-PA 231..518 306..593 1013 64.1 Plus
Dgri\GH22495-PA 509 GH22495-PA 270..498 362..585 596 48.9 Plus
Dgri\GH13825-PA 605 GH13825-PA 244..529 329..603 589 41.3 Plus
Dgri\GH22488-PA 513 GH22488-PA 306..490 395..580 509 48.9 Plus
Dgri\GH23447-PA 473 GH23447-PA 267..431 395..571 430 45.3 Plus
Dgri\GH22499-PA 569 GH22499-PA 19..134 12..128 419 59 Plus
Dgri\GH22495-PA 509 GH22495-PA 14..125 18..128 233 40.2 Plus
Dgri\GH13825-PA 605 GH13825-PA 6..136 7..119 206 35.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-PA 634 CG6254-PA 1..634 1..634 3394 100 Plus
CG17568-PA 513 CG17568-PA 3..509 14..592 817 33.8 Plus
CG10366-PA 578 CG10366-PA 128..539 212..618 655 34.7 Plus
wek-PB 470 CG4148-PB 270..457 392..580 524 51.3 Plus
wek-PA 470 CG4148-PA 270..457 392..580 524 51.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22252-PA 572 GI22252-PA 135..570 209..630 1039 49.3 Plus
Dmoj\GI22251-PA 522 GI22251-PA 6..514 18..585 811 34.1 Plus
Dmoj\GI20171-PA 576 GI20171-PA 210..485 329..585 522 41.3 Plus
Dmoj\GI22250-PA 538 GI22250-PA 351..535 395..580 521 50.5 Plus
Dmoj\GI22252-PA 572 GI22252-PA 11..132 6..128 409 56.9 Plus
Dmoj\GI15092-PA 559 GI15092-PA 150..512 170..559 350 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23841-PA 564 GL23841-PA 192..564 245..631 1193 59.1 Plus
Dper\GL24005-PA 550 GL24005-PA 7..543 18..587 768 32.3 Plus
Dper\GL24004-PA 457 GL24004-PA 224..417 386..580 540 48.2 Plus
Dper\GL23841-PA 564 GL23841-PA 1..134 1..132 440 57.5 Plus
Dper\GL26254-PA 213 GL26254-PA 3..163 450..602 367 45.3 Plus
Dper\GL19918-PA 564 GL19918-PA 278..502 326..559 349 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27072-PA 566 GA27072-PA 10..566 10..631 1009 40.4 Plus
Dpse\GA26476-PA 535 GA26476-PA 7..528 18..587 770 33.1 Plus
Dpse\GA10277-PA 585 GA10277-PA 253..535 329..602 553 40.1 Plus
Dpse\GA26475-PA 457 GA26475-PA 195..417 345..580 542 42.8 Plus
Dpse\GA13064-PA 871 GA13064-PA 291..484 363..556 347 38.3 Plus
Dpse\GA10277-PA 585 GA10277-PA 13..123 15..118 220 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26181-PA 586 GM26181-PA 1..586 49..634 2599 91 Plus
Dsec\GM17024-PA 513 GM17024-PA 3..509 14..592 728 33.3 Plus
Dsec\GM14198-PA 471 GM14198-PA 270..462 392..585 515 50 Plus
Dsec\GM17374-PA 250 GM17374-PA 6..212 421..619 491 46.9 Plus
Dsec\GM12283-PA 869 GM12283-PA 301..493 364..556 341 37.9 Plus
Dsec\GM17374-PA 250 GM17374-PA 31..136 358..468 155 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20730-PA 228 GD20730-PA 61..228 467..634 885 98.2 Plus
Dsim\GD24229-PA 578 GD24229-PA 240..540 329..619 599 40.2 Plus
Dsim\GD21941-PA 471 GD21941-PA 270..462 392..585 511 49.5 Plus
Dsim\GD21772-PA 453 GD21772-PA 309..451 390..532 465 56.6 Plus
Dsim\GD20730-PA 228 GD20730-PA 1..61 1..61 349 100 Plus
Dsim\GD16618-PA 253 GD16618-PA 6..203 358..559 328 36.9 Plus
Dsim\GD21772-PA 453 GD21772-PA 3..120 14..128 231 39.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10855-PA 593 GJ10855-PA 11..591 6..630 1405 46.3 Plus
Dvir\GJ10854-PA 558 GJ10854-PA 6..547 9..585 788 33.7 Plus
Dvir\GJ13556-PA 622 GJ13556-PA 271..556 329..603 590 41.3 Plus
Dvir\GJ10853-PA 576 GJ10853-PA 361..554 383..580 524 48 Plus
Dvir\GJ18900-PA 571 GJ18900-PA 297..516 331..559 346 32.6 Plus
Dvir\GJ13556-PA 622 GJ13556-PA 5..157 7..149 189 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14371-PA 559 GK14371-PA 17..559 18..631 1118 42.2 Plus
Dwil\GK14370-PA 482 GK14370-PA 231..475 315..585 598 42.5 Plus
Dwil\GK14921-PA 665 GK14921-PA 262..550 329..602 559 39.1 Plus
Dwil\GK14368-PA 406 GK14368-PA 193..388 395..589 471 46.2 Plus
Dwil\GK10984-PA 855 GK10984-PA 271..465 363..556 350 38.1 Plus
Dwil\GK14370-PA 482 GK14370-PA 6..450 18..476 319 25.4 Plus
Dwil\GK14921-PA 665 GK14921-PA 2..115 10..122 244 39.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24700-PA 631 GE24700-PA 1..631 1..634 2763 86.9 Plus
Dyak\GE12664-PA 511 GE12664-PA 309..509 390..592 592 51.2 Plus
Dyak\GE13276-PA 582 GE13276-PA 244..544 329..619 589 39.9 Plus
Dyak\GE19389-PA 465 GE19389-PA 259..456 387..585 511 47.2 Plus
Dyak\wdn-PA 869 GE10494-PA 301..493 364..556 341 37.9 Plus