Clone LD13772 Report

Search the DGRC for LD13772

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:137
Well:72
Vector:pBS SK-
Associated Gene/TranscriptUbcE2H-RA
Protein status:LD13772.pep: gold
Preliminary Size:1815
Sequenced Size:1574

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2257 2002-06-01 Blastp of sequenced clone
CG2257 2003-01-01 Sim4 clustering to Release 3
Ubc-E2H 2008-04-29 Release 5.5 accounting
Ubc-E2H 2008-08-15 Release 5.9 accounting
Ubc-E2H 2008-12-18 5.12 accounting

Clone Sequence Records

LD13772.complete Sequence

1574 bp (1574 high quality bases) assembled on 2002-06-01

GenBank Submission: AY118510

> LD13772.complete
CTGCAGGCGCTGGTCACACTACAAATTTTCCAAGTCTTTCATATTCCGGA
AAACAAAACAAAATTAATTAAGTAATTAGACACGAAGTATCTAGGAAAAT
GCACAGGGAATCACGGTGATTAAACGGAAATGTGGAGAAGTATCGAAGCG
TAAGAATCGACGGCGACCGTCAGTCCACAATAACACCACCCACGAGCAAC
AATAACAACAATACAACTAAAACGGGAGGCAACTGCAAATATACACACAC
CGAGAGAAATCAAAATAAAAAGGCAGCTCCCGTTTTGCTCTGGACGGTGC
CAGTGAGAGTTGACGAATGCGGAGCAGTTCGTGGCTGGCGGAGCAGCAGC
TGGGCAACCGGAAGCGGATAGCGGATGTAACTCAATAGCAATATTTCAAA
GGAACAACATTAAGCATACAACTTATAGATAACAAAGATAACACCGCCTT
AGCCTTAGTGAAAAACAACGAGGAGACGACCACTCCAAAACCAAATCAAA
TCAAACCAAACCAATCAAATCAAAAGCCAGGCAACTACAATCCCAAATAA
ACCAACAAAATGTCCTCGCCCAGTGCCGGAAAGCGACGCATGGACAACGA
TGTGATCAAGCTGATCGAATCAAAGCACGAGGTGACCATCCTGGGAGGCC
TCAACGAGTTCCACGTCAAGTTCTTCGGTCCAACGGAGACGCCCTACGAG
GGCGGCGTGTGGAAGGTGCGCGTCTACCTGCCCGACAACTATCCCTTCAA
GTCACCGAGCATTGGTTTTGTGAACAAGATCTACCATCCGAACATTGACG
AATCCTCGGGTACGGTGTGCCTGGATGTTATCAATCAGGCCTGGACGGCG
TTGTACGATCTATCGAACATATTTGAATCGTTCTTGCCGCAGCTGCTCAC
ATATCCCAATCCGGTCGATCCGCTCAATCGGGATGCGGCCGCATTGTACC
TGCACGAGCCGGAGGAGTATCATCGCAAGGTGGCCGACTATGTGCAGCGC
TATGCCACCGAGGACGCGTTGCGGGCGGCGCAGCAGGAGCGGGAGAGCAG
CGACAGCGAGTCGAGCATGTCCGACTACAGTGAGGATGAGGCCAGGGACA
TGGAATTATAATATCGGTTGGACCGCCAGCCTACGGAACTACCGCTAACA
CTAACACTGACAACAGCCTAATACAAATGCTTCGAGAATCCATTTTCCTG
CCACCCAATTTCCCCAAACAAACACACTCACTTATACTTTCACCATACCC
CTTCAGTTGGCGATGGAACAAAAAGCAACAATATATATATATATATATCT
ATATATATATATACATAATTGATAAATGATAATTGGATTTTAAGATAGAA
AGTGATTCGATGATGGCGTGTGATGATCAGCGCACACACGCAGATACATA
TAAATATATACATAATATATATATATATATACACTAATGTAAGCAGAAAG
AAAAACAAGATTTAAAAACTCTTAGTTTAGCCATCAGTAGCTGATAACAA
AACGGATTGGAGCAACGATCGCAACAGATCATAGCAGATATATAGACCAC
AGTAACAAAAAAAAAAAAAAAAAA

LD13772.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc-E2H.f 2936 Ubc-E2H.f 73..1638 1..1566 7830 100 Plus
Ubc-E2H-RA 2559 Ubc-E2H-RA 73..1638 1..1566 7830 100 Plus
Ubc-E2H.e 2752 Ubc-E2H.e 389..1526 429..1566 5690 100 Plus
Ubc-E2H.e 2752 Ubc-E2H.e 13..393 1..381 1890 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7980724..7982009 1556..271 6385 99.8 Minus
chrX 22417052 chrX 7985648..7985920 273..1 1350 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2H-RB 552 CG2257-PB 1..552 560..1111 2760 100 Plus
UbcE2H-RC 552 CG2257-PC 1..552 560..1111 2760 100 Plus
UbcE2H-RA 552 CG2257-PA 1..552 560..1111 2760 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:00:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2H-RA 2894 CG2257-RA 19..1574 1..1556 7780 100 Plus
UbcE2H-RC 2328 CG2257-RC 188..1473 271..1556 6430 100 Plus
UbcE2H-RB 2292 CG2257-RB 154..1437 273..1556 6420 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2H-PB 183 CG2257-PB 1..183 560..1108 860 100 Plus
UbcE2H-PC 183 CG2257-PC 1..183 560..1108 860 100 Plus
UbcE2H-PA 183 CG2257-PA 1..183 560..1108 860 100 Plus
CG14739-PA 206 CG14739-PA 12..156 569..1006 346 45.9 Plus
ben-PE 151 CG18319-PE 35..151 659..1015 268 42.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8088854..8090149 1566..271 6480 100 Minus
X 23542271 X 8093774..8094046 273..1 1365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8096952..8098247 1566..271 6480 100 Minus
X 23527363 X 8101872..8102144 273..1 1365 100 Minus
Blast to na_te.dros performed 2014-11-27 03:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 3177..3276 1324..1423 130 61.4 Plus

LD13772.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:24:53 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7985649..7985920 1..272 99   Minus
chrX 7980724..7982007 273..1556 91 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:00 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RB 1..552 560..1111 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:25 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RB 1..552 560..1111 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:40 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RA 1..552 560..1111 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:01 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RB 1..552 560..1111 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:53 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
UbcE2H-RA 1..552 560..1111 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:04:16 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RA 19..1574 1..1556 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:24 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RA 19..1574 1..1556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:40 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RA 19..1574 1..1556 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:01 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc-E2H-RA 19..1574 1..1556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:53 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
UbcE2H-RA 19..1574 1..1556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:24:53 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
X 8093775..8094046 1..272 100   Minus
X 8088864..8090147 273..1556 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:40 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7987808..7988079 1..272 100   Minus
arm_X 7982897..7984180 273..1556 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:26 Download gff for LD13772.complete
Subject Subject Range Query Range Percent Splice Strand
X 8101873..8102144 1..272 100   Minus
X 8096962..8098245 273..1556 100 <- Minus

LD13772.pep Sequence

Translation from 559 to 1110

> LD13772.pep
MSSPSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGV
WKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYD
LSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYAT
EDALRAAQQERESSDSESSMSDYSEDEARDMEL*

LD13772.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20984-PA 183 GF20984-PA 1..183 1..183 980 100 Plus
Dana\GF17748-PA 222 GF17748-PA 9..169 2..163 392 45.7 Plus
Dana\GF19231-PA 151 GF19231-PA 35..151 34..152 274 43.7 Plus
Dana\GF18131-PA 147 GF18131-PA 30..146 31..149 237 36.1 Plus
Dana\GF16080-PA 151 GF16080-PA 1..147 1..147 228 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17585-PA 183 GG17585-PA 1..183 1..183 980 100 Plus
Dere\GG17163-PA 203 GG17163-PA 12..170 4..163 363 44.4 Plus
Dere\GG17819-PA 151 GG17819-PA 35..151 34..152 270 42.9 Plus
Dere\GG24249-PA 151 GG24249-PA 35..129 34..130 244 44.3 Plus
Dere\GG21088-PA 147 GG21088-PA 30..146 31..149 237 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24347-PA 183 GH24347-PA 1..183 1..183 966 98.4 Plus
Dgri\GH15555-PA 189 GH15555-PA 9..155 2..149 383 46.6 Plus
Dgri\GH22592-PA 151 GH22592-PA 35..151 34..152 271 42.9 Plus
Dgri\GH17677-PA 151 GH17677-PA 35..151 34..152 269 42 Plus
Dgri\GH14086-PA 147 GH14086-PA 30..146 31..149 237 36.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2H-PB 183 CG2257-PB 1..183 1..183 966 100 Plus
UbcE2H-PC 183 CG2257-PC 1..183 1..183 966 100 Plus
UbcE2H-PA 183 CG2257-PA 1..183 1..183 966 100 Plus
CG14739-PA 206 CG14739-PA 12..190 4..180 358 41.7 Plus
ben-PE 151 CG18319-PE 35..151 34..152 268 42.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11001-PA 183 GI11001-PA 1..183 1..183 972 99.5 Plus
Dmoj\GI22479-PA 189 GI22479-PA 9..169 2..163 380 43.8 Plus
Dmoj\GI22711-PA 151 GI22711-PA 35..151 34..152 271 42.9 Plus
Dmoj\GI21493-PA 151 GI21493-PA 35..151 34..152 269 42 Plus
Dmoj\GI10619-PA 147 GI10619-PA 30..146 31..149 237 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26898-PA 183 GL26898-PA 1..183 1..183 976 99.5 Plus
Dper\GL21579-PA 192 GL21579-PA 9..155 2..149 358 45.3 Plus
Dper\GL14825-PA 151 GL14825-PA 35..151 34..152 270 42.9 Plus
Dper\GL23670-PA 147 GL23670-PA 30..146 31..149 237 36.1 Plus
Dper\GL22213-PA 151 GL22213-PA 1..147 1..147 228 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15327-PA 183 GA15327-PA 1..183 1..183 976 99.5 Plus
Dpse\GA13211-PA 192 GA13211-PA 9..155 2..149 362 45.3 Plus
Dpse\GA14886-PA 151 GA14886-PA 35..151 34..152 270 42.9 Plus
Dpse\GA26693-PA 147 GA26693-PA 30..146 31..149 237 36.1 Plus
Dpse\GA15184-PA 151 GA15184-PA 1..147 1..147 228 34.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11213-PA 183 GM11213-PA 1..183 1..183 980 100 Plus
Dsec\GM26045-PA 206 GM26045-PA 12..156 4..149 355 45.2 Plus
Dsec\GM26306-PA 206 GM26306-PA 12..156 4..149 355 45.2 Plus
Dsec\GM17649-PA 151 GM17649-PA 35..151 34..152 270 42.9 Plus
Dsec\GM16552-PA 151 GM16552-PA 35..129 34..130 246 42.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16131-PA 183 GD16131-PA 1..183 1..183 980 100 Plus
Dsim\GD20607-PA 206 GD20607-PA 12..156 4..149 355 45.2 Plus
Dsim\GD17149-PA 151 GD17149-PA 35..151 34..152 270 42.9 Plus
Dsim\GD21999-PA 151 GD21999-PA 35..129 34..130 246 42.3 Plus
Dsim\GD20402-PA 147 GD20402-PA 30..146 31..149 237 36.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15600-PA 183 GJ15600-PA 1..183 1..183 965 98.4 Plus
Dvir\GJ10077-PA 189 GJ10077-PA 9..169 2..163 376 43.2 Plus
Dvir\GJ23435-PA 151 GJ23435-PA 35..151 34..152 271 42.9 Plus
Dvir\GJ19035-PA 151 GJ19035-PA 35..151 34..152 269 42 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 30..146 31..149 237 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25273-PA 183 GK25273-PA 1..183 1..183 972 99.5 Plus
Dwil\GK11573-PA 191 GK11573-PA 12..163 2..154 366 45.8 Plus
Dwil\GK25846-PA 151 GK25846-PA 35..151 34..152 270 42.9 Plus
Dwil\GK21643-PA 151 GK21643-PA 35..151 34..152 260 38.7 Plus
Dwil\GK11688-PA 147 GK11688-PA 30..146 31..149 237 36.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17485-PA 183 GE17485-PA 1..183 1..183 980 100 Plus
Dyak\GE24553-PA 206 GE24553-PA 12..170 4..163 360 45 Plus
Dyak\GE17114-PA 151 GE17114-PA 35..151 34..152 270 42.9 Plus
Dyak\GE24917-PA 151 GE24917-PA 30..129 29..130 244 42.2 Plus
Dyak\eff-PA 147 GE26430-PA 30..146 31..149 237 36.1 Plus

LD13772.hyp Sequence

Translation from 559 to 1110

> LD13772.hyp
MSSPSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGV
WKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYD
LSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYAT
EDALRAAQQERESSDSESSMSDYSEDEARDMEL*

LD13772.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2H-PB 183 CG2257-PB 1..183 1..183 966 100 Plus
UbcE2H-PC 183 CG2257-PC 1..183 1..183 966 100 Plus
UbcE2H-PA 183 CG2257-PA 1..183 1..183 966 100 Plus
CG14739-PA 206 CG14739-PA 12..190 4..180 358 41.7 Plus
ben-PE 151 CG18319-PE 35..151 34..152 268 42.9 Plus