Clone LD13959 Report

Search the DGRC for LD13959

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:139
Well:59
Vector:pBS SK-
Associated Gene/TranscriptSuUR-RA
Protein status:LD13959.pep: gold
Preliminary Size:3332
Sequenced Size:3769

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7869 2001-01-01 Release 2 assignment
CG7869 2003-01-01 Sim4 clustering to Release 3
CG7869 2003-04-25 Blastp of sequenced clone
SuUR 2008-04-29 Release 5.5 accounting
SuUR 2008-08-15 Release 5.9 accounting
SuUR 2008-12-18 5.12 accounting

Clone Sequence Records

LD13959.complete Sequence

3769 bp (3769 high quality bases) assembled on 2003-04-25

GenBank Submission: BT010066

> LD13959.complete
AAATAGAATTGGAGCCAAAAATAATATTTTCTTCTTGTTCGATTGTTAAG
CCTTTTCCCGCGCCCCCGCCATGACTAACAGCGCTTAACCCAATTTCCCA
AAAGGGACGAAAATTGTCCTCCGAAAAAATTGAAGCTTAACTAGTTTCAA
CACATGTACGAGATCCAACATCCTGTTATCATCAACAACAACTACAACGT
GGTGGACATACTGCATCCGGAGAATATCGAATTCGATGGGCCGTCTGCGG
CGCGAAAGATGATAATTGGTTCATTTTCGATGTTCGTGATCTTCTCGTAC
CTGCAACTATTCTACATCCTGGTTGCCATCTATCTGGCCCTGCATCACGC
ACACCATTGATTCGAATTCTCTGAAGGATCATGTATCACTTTGTATCCGA
GCAAACGCCGGAGGTGCGGCTCACAGATGAGGCACTGGTCACGAGCCACG
TGACGCAGTACCTCAAGAGCTTTCAACTGGATGCCGTCCGCTTCGTCTAC
GATCGTTTGGCTAAGCGGGAATTCTGCATCCTGAATGATGAGAGTGGCCT
TGGAAAGGTCGCTACGGTGGCGGCACTTCTAAGTGCCCTACCACCCGCCA
AAAAAACACTTGTGGTGCTCCAGAACGATGAGCAACTGCTCACCGGTTGG
CGATTCCATTTGGACACTCTCACTGACCTCCAGGTGTACATCATTCAGGG
GGTGCAAGATACCACCGACTCCCCGCACAGCGTTTACCTGGCGAAATGGA
GCCAACTACGGAGCATTGGAGATCTCAGTCGCCTCAAGTTCGACTACATT
ATGGTGGATAATCGGGGGCATTCGCTGAACAACAGCTTTTGCACTTCCAT
GCTGCTGAAGCAATTCGAGGGACGGGTAAACGTTCTTATCTCCAGTGTTG
ACGTTACGTCCGACGTTAGGTTGCTCTACAATGTTCTACGGTTGGGCGGC
CGACTGGAGCATCAGTACAAAAGCTTTGCGAGCTTCGATCGAAAATTCCA
TCTGCCAGATCCGAAGGAGGTATTCAGTAAGCGCATAGATCTCGAGGAAT
ACTACAAGCAGCGGGGATTCCTCAGCGAGTACATCAAGGACTTTCGTCTG
CGTCGTTTTCGTCATCAATTCGACAAGTCACTGCCACTTGTCGCACCGGA
GCAATACAAACACAATCTGAATCTCTGGTTGGCCTCAAAGAACAGCCAGA
GCACAATAAGCGGCTCAGATGTGTGCTCTACAATCGCTTCCATAGACAAC
AATCCGGCTCAGCAAAATAAAACTGGGCTCTTTGAAGAAACGGATAGGTT
ATCCGAGCACAGCGTGGATGATGTGGCAATGTCACCGCTGATATTCGAGT
ATTCCGAGTCTGACGATGAACCCCTAACAGTAGAACCTGATGCAGATCAA
AACCCGGTATTAGTTGTATCCAGCGATGATTGTGAGATTGTAACACCTCC
AAGTACTCCGCAAAATCGAACGCCCTCATTAAATGAATCACCAAGGACGA
AATCAAAGAAAAAATTTAGCAAAAAAACGTCACCGCGCAAAAAAGCTGAT
CTCACCGATTCCGAAGAGGATGATGAAGCGACCGATAATATGCCGCCAAG
GAAGAGAACTCGTGCAGCCACCGTTCATCTGACACCTAAGACAAGGAGAC
TCAATGTTCGAATTTTAAGGGTTTCCCTCGATACTCTGAGCACACCACCA
CCGTCCAGAACCACTACTGCGATCGTAACGCCCAAAACGGAGCCCACAGC
TAGAAGAAAAAATCTGAAAAAGCGCACGGTGAGCCCAGTGGATGTGGGTC
GTCCAGCCACAAGGGGAATGCAGCGCCTAACACGATCCGCTGAAACAAAA
ATAAACAGTAAGTACTTGAAACATCGCTCATTGGATGATGTCAAGCGTAG
CTTTCCAAGGAGAGTCAAGTTGGAGGGTAACCAAACGCCCAGAAGTAGCA
AACAAATAGTGAAGCAGGAGCCTAAGTCTAAAGTCGGGCAGGAAAAGAAA
CAGAAGACGGTGGATGTACCTGCTCAAGGAACTGCGAAACGAAAGCCTGG
ACGTCCGAGAAAATGCCAAACCAAGACTGAAGATTTGGGGAAGACAAAGA
CTAAGCCGAATTCAAAGCACTTGCCACCTACTCCTCAAGTTCTCAGTGGT
AGCTCGTTGTCCTCGGAGTACATGCAATGTGCTCAGCGAATACCAGACAA
TTTGGATGCCATTGAGTCGCCCGCTTTTCGTGTGCCCTTTACACCTCAAC
AAACTCCAATGCTTCTAACCTTGCCGTCTACACACAATTTGCTCAACGAT
TCTGAGGTGGTGTCTATTCCGCTTTACAAAGATCCAGTTGAGACAGTGGT
GATCAATAGCTCGCACGATGAGTGTTCTCCGCAGGATCCATCGCAGAGTC
GTCGCACCAAGGCTTTGAAAAGAAAACGCAAACCCGTGACGTCCGTCAAT
TCAAGTTTCGGCGGCGGATTGGGTCTACCACCGGCCAAGAGGAGTGCCAA
CAAATCTCCAGATCTATTTAGCATATCCTCGGAACACTCGCAGATTCCGC
TGGCGCAACCAAGACCCTCATCGCCCTTCGAAGGCTTTAAGATCTTTGGC
TCTGAGGTGAAGCAGTTTCAGCAGCAGCTAGCGAAAGTAAATATATCGGT
GCCAAAAAAGAAGCGAGATCGCTCGTGTTTGGATATCCTGGAGCAAATGT
TCGAGCCACGACAACAGCAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCA
ACCTTGCCACTGACCCAGAAGGATGATGCAGAGTCTACCATTACGCAGAG
AAGAAGAACCCTGCTGGAAGATGACTTCTTTGAGATAACGAACAATGGCC
AATTTGGCAGTCGCATGCGATTGAACTCCTCTGGCGAAGTATCGCCCGTG
CAACCGGATCAACAGTCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAA
TTATTTGATAGGTTCTGGAATTACGCAGGAGCGAACGCAACCTTCGAATG
GTAATCGCAATTCCATTCTTGCATCGCTGCGCAAGTCACCCAAATCTCCC
AAACAGGGTGCTAAATCCACTCAGGCCACGAAACTAACACGCTGGTTTGG
CTCCGTCTTCGGCGGTGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTA
GTGCACCAAGTACGCCGGTGAATTCATCCACAAGTGCAGCAGCTTGTCAA
ACGCGATCGGCGAGAAGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCG
ATTGGAACTGTTCAAGTGATGAACAGCAATCAATGAAAATGACAAAAACC
AAATCAAATCAAATCCAATTATTGAATATATAATGAATGAAGGAATATAT
AACATATAGTACGAAATCAAAAGTTAACAGCATCCAAATATGAGGTTGTA
AAATCAAATTGCACAGGACCGTCTAGCTAATTTAGTTAAAATTATACTTT
GTGTGCGCATTTTGAAGAGTAAGGTTACCATAAAATTGAAAAGACACTGC
ATAATATTGTATGCGTATCTTGTAAGTAGATATAATTGGTAAATTATTAG
TTCACAAGTTTATCTAGTTTCTCAATTCATTTTCCAAAATGTGCCACCTG
ATTTAGACGTGTTTTTTTTTTTTAAATTATTTCAATACGCATTCAAAGTG
TATTCAACAATTTTAAAGTAACGAAAGATATCGTTTTTAGAAGCAAGTAC
CGTGTAATTTTGTATCATCGTTAAATAAACACAGGGTTTACATTTAAAAA
CAAAAAAAAAAAAAAAAAA

LD13959.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-RA 3823 SuUR-RA 72..3823 1..3751 18720 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11057238..11059921 1088..3751 12630 98.2 Plus
chr3L 24539361 chr3L 11055893..11056595 1..708 3370 98.7 Plus
chr3L 24539361 chr3L 11056705..11056906 707..908 995 99.5 Plus
chr3L 24539361 chr3L 11056972..11057152 908..1088 875 98.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-RA 2889 CG7869-PA 1..2889 381..3269 14445 100 Plus
CG45101-RA 207 CG45101-PA 1..207 154..360 1035 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-RA 3776 CG7869-RA 25..3776 1..3751 18710 100 Plus
CG45101-RA 3776 CG45101-RA 25..3776 1..3751 18710 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-PA 962 CG7869-PA 1..962 381..3266 4615 100 Plus
CG45101-PA 68 CG45101-PA 1..60 154..333 237 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11066361..11069028 1088..3754 13290 100 Plus
3L 28110227 3L 11065015..11065722 1..708 3540 100 Plus
3L 28110227 3L 11065828..11066029 707..908 1010 100 Plus
3L 28110227 3L 11066095..11066275 908..1088 905 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11059461..11062128 1088..3754 13300 99.9 Plus
3L 28103327 3L 11058115..11058822 1..708 3540 100 Plus
3L 28103327 3L 11058928..11059129 707..908 1010 100 Plus
3L 28103327 3L 11059195..11059375 908..1088 905 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:27:39 has no hits.

LD13959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:02:43 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11059510..11059921 3342..3751 93   Plus
chr3L 11057238..11059496 1088..3341 98 -> Plus
chr3L 11056973..11057151 909..1087 98 -> Plus
chr3L 11056707..11056906 709..908 99 -> Plus
chr3L 11055893..11056595 1..708 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:14 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 1..2889 381..3269 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:58 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 1..2889 381..3269 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:28 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 1..2889 381..3269 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:25 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 1..2889 381..3269 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:02:43 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 1..2889 381..3269 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:55:47 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 19..3770 1..3751 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:58 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 19..3770 1..3751 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:28 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 25..3776 1..3751 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:25 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 19..3770 1..3751 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:02:43 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
CG45101-RA 25..3776 1..3751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:02:43 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11066361..11069025 1088..3751 99   Plus
3L 11066096..11066274 909..1087 100 -> Plus
3L 11065830..11066029 709..908 100 -> Plus
3L 11065015..11065722 1..708 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:28 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11059461..11062125 1088..3751 99   Plus
arm_3L 11059196..11059374 909..1087 100 -> Plus
arm_3L 11058930..11059129 709..908 100 -> Plus
arm_3L 11058115..11058822 1..708 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:27 Download gff for LD13959.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11059461..11062125 1088..3751 99   Plus
3L 11059196..11059374 909..1087 100 -> Plus
3L 11058930..11059129 709..908 100 -> Plus
3L 11058115..11058822 1..708 100 -> Plus

LD13959.pep Sequence

Translation from 380 to 3268

> LD13959.pep
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDD
CEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEA
TDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVT
PKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRS
LDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQG
TAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQC
AQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYK
DPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLP
PAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQL
AKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDA
ESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPS
QANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQAT
KLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGAS
GPTKRKRLELFK*

LD13959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 12:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\SuUR-PA 959 GF10628-PA 1..959 1..962 3175 66.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 12:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\SuUR-PA 962 GG15473-PA 1..962 1..962 4344 88.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 12:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14929-PA 981 GH14929-PA 1..981 1..962 2055 47.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-PA 962 CG7869-PA 1..962 1..962 4922 100 Plus
Mur2B-PB 1144 CG14796-PB 501..1081 358..935 169 19.7 Plus
Mur2B-PC 1795 CG14796-PC 501..1081 358..935 169 19.7 Plus
Mur2B-PA 1795 CG14796-PA 501..1081 358..935 169 19.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 12:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\SuUR-PA 972 GI11447-PA 1..972 1..962 2095 49.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 12:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22910-PA 989 GL22910-PA 1..989 1..962 2771 59.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 12:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\SuUR-PA 986 GA20646-PA 1..986 1..962 2787 59.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 12:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\SuUR-PA 957 GM25245-PA 1..957 1..962 4598 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 12:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\SuUR-PA 954 GD14278-PA 1..954 1..962 4597 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 12:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\SuUR-PA 1024 GJ13644-PA 1..1024 1..962 2084 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 12:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11263-PA 911 GK11263-PA 1..911 1..962 2018 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 12:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\SuUR-PA 965 GE21782-PA 1..965 1..962 4443 89.3 Plus

LD13959.hyp Sequence

Translation from 380 to 3268

> LD13959.hyp
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDD
CEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEA
TDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVT
PKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRS
LDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQG
TAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQC
AQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYK
DPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLP
PAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQL
AKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDA
ESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPS
QANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQAT
KLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGAS
GPTKRKRLELFK*

LD13959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-PA 962 CG7869-PA 1..962 1..962 4922 100 Plus
Mur2B-PB 1144 CG14796-PB 501..1081 358..935 169 19.7 Plus
Mur2B-PC 1795 CG14796-PC 501..1081 358..935 169 19.7 Plus
Mur2B-PA 1795 CG14796-PA 501..1081 358..935 169 19.7 Plus