Clone LD14109 Report

Search the DGRC for LD14109

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:141
Well:9
Vector:pBS SK-
Associated Gene/TranscriptAP-1sigma-RA
Protein status:LD14109.pep: gold
Preliminary Size:1295
Sequenced Size:1079

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5864 2001-01-01 Release 2 assignment
CG5864 2001-10-10 Blastp of sequenced clone
CG5864 2003-01-01 Sim4 clustering to Release 3
AP-1sigma 2008-04-29 Release 5.5 accounting
AP-1sigma 2008-08-15 Release 5.9 accounting
AP-1sigma 2008-12-18 5.12 accounting

Clone Sequence Records

LD14109.complete Sequence

1079 bp (1079 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061172

> LD14109.complete
CTCGCTGGCTGCATGGAAAAATAAGATTTTTCCATATATTTTGTAATCCC
AGCCCACGGAAAAACTTCACCACACAGAGAAAAACAAAAATAAATGATGC
TTTTCATGCTGCTGTTTAGTCGGCAGGGCAAACTGCGGTTACAAAAGTGG
TACATGGCCTATCCGGATAAGGTGAAAAAGAAGATCACCCGGGAACTGGT
CACTACGATACTGGCCCGCAAGCCCAAAATGTGCTCCTTTCTGGAGTGGA
AGGACTGCAAAATTGTCTACAAAAGGTATGCCAGCTTGTATTTCTGTTGC
GCCATCGAGCAGAACGACAACGAACTGCTGACACTGGAGATCATTCATCG
CTATGTGGAGCTGTTGGATAAGTACTTCGGCAGCGTCTGCGAGCTGGACA
TTATCTTTAACTTTGAAAAAGCATACTTTATCCTGGATGAGCTGCTCATT
GGCGGCGAAATCCAGGAGACGTCCAAAAAGAACGTACTTAAGGCGATTGC
CTCGCAGGATCTGCTCCAAGAGGATGAGACCCCGCAGAGTTTCTTCGACG
ATCACGGCCTGGGCTAAGTTGGCTCTATGCAAAAGTAACGCCAGAAAGGC
ATTATCTATATTGAACCCATTTAAAGTCGCCTTAATTGTATGTGTATTTA
ACGTAACCCAAAAGTATACCGGTTCTATTGTAATTTAACCACCCTGTGTC
AGCATAAAAAACATTGTGTATAGAAGTGCTGTTAAACCTATTCCTAATTT
CGCTTGGCAAATGCAATTTGCAATACATTTAATTTCACAAAAAAGCATCA
ATATCGGTTGCTCACACACGTTCATATTTGTAAAGATTAACTTAATGATA
AGCAAAGTAAAGCGATGCGATTAATCGACGGTGTGCTCAACTCTATAGTT
GTAAGTTAAAAGCCCTATAAATATATAAAAATTGCTGTATCCAAAGTAAC
CAATCAAAACTCTGTTTACTTTATGCATTCTTTGCTGCAAATAAAGATGG
TATCGAGCGTGAGAGTTTTTTTTTTTCAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD14109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 1193 AP-1sigma-RA 145..1172 1..1028 5110 99.8 Plus
AP-1sigma.a 1272 AP-1sigma.a 145..668 1..524 2620 100 Plus
AP-1sigma.b 1037 AP-1sigma.b 176..697 1..522 2610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19785428..19785934 521..1027 2505 99.6 Plus
chr3R 27901430 chr3R 19782410..19782591 96..277 910 100 Plus
chr3R 27901430 chr3R 19782835..19782973 385..523 695 100 Plus
chr3R 27901430 chr3R 19782657..19782769 274..386 565 100 Plus
chr3R 27901430 chr3R 19782082..19782177 1..96 480 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 474 CG5864-PA 1..474 94..567 2370 100 Plus
AP-1sigma-RC 474 CG5864-PC 1..431 94..524 2155 100 Plus
AP-1sigma-RB 474 CG5864-PB 1..431 94..524 2155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 1079 CG5864-RA 53..1079 1..1027 5105 99.8 Plus
AP-1sigma-RC 795 CG5864-RC 53..576 1..524 2620 100 Plus
AP-1sigma-RB 1181 CG5864-RB 53..576 1..524 2620 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-PA 157 CG5864-PA 1..157 94..564 821 100 Plus
AP-1sigma-PC 157 CG5864-PC 1..156 94..561 761 94.9 Plus
AP-1sigma-PB 157 CG5864-PB 1..156 94..561 761 94.9 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 94..528 746 99.3 Plus
AP-2sigma-PA 142 CG6056-PA 1..142 94..519 366 46.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23962049..23962556 521..1028 2510 99.6 Plus
3R 32079331 3R 23959031..23959212 96..277 910 100 Plus
3R 32079331 3R 23959456..23959594 385..523 695 100 Plus
3R 32079331 3R 23959278..23959390 274..386 565 100 Plus
3R 32079331 3R 23958703..23958798 1..96 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23702880..23703387 521..1028 2510 99.6 Plus
3R 31820162 3R 23699862..23700043 96..277 910 100 Plus
3R 31820162 3R 23700287..23700425 385..523 695 100 Plus
3R 31820162 3R 23700109..23700221 274..386 565 100 Plus
3R 31820162 3R 23699534..23699629 1..96 480 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:38:58 has no hits.

LD14109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:37:20 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19785430..19785934 523..1027 99   Plus
chr3R 19782835..19782972 385..522 100 -> Plus
chr3R 19782659..19782767 276..384 100 -> Plus
chr3R 19782411..19782589 97..275 100 -> Plus
chr3R 19782082..19782177 1..96 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:25 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 94..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:40 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 94..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:53:36 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 94..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:28 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 94..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:20 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 94..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:02 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 50..1076 1..1027 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:40 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 50..1076 1..1027 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:36 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 53..1079 1..1027 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:29 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 50..1076 1..1027 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:20 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 53..1079 1..1027 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:20 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23962051..23962555 523..1027 99   Plus
3R 23959456..23959593 385..522 100 -> Plus
3R 23959280..23959388 276..384 100 -> Plus
3R 23959032..23959210 97..275 100 -> Plus
3R 23958703..23958798 1..96 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:36 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19787773..19788277 523..1027 99   Plus
arm_3R 19785178..19785315 385..522 100 -> Plus
arm_3R 19785002..19785110 276..384 100 -> Plus
arm_3R 19784754..19784932 97..275 100 -> Plus
arm_3R 19784425..19784520 1..96 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:23 Download gff for LD14109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23702882..23703386 523..1027 99   Plus
3R 23700287..23700424 385..522 100 -> Plus
3R 23700111..23700219 276..384 100 -> Plus
3R 23699863..23700041 97..275 100 -> Plus
3R 23699534..23699629 1..96 100 -> Plus

LD14109.pep Sequence

Translation from 93 to 566

> LD14109.pep
MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFL
EWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCE
LDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQEDETPQSF
FDDHGLG*

LD14109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17027-PA 156 GF17027-PA 1..156 2..157 821 100 Plus
Dana\GF17262-PA 142 GF17262-PA 1..142 1..142 365 46.5 Plus
Dana\GF12884-PA 191 GF12884-PA 1..152 1..146 255 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11239-PA 156 GG11239-PA 1..156 2..157 821 100 Plus
Dere\GG14749-PA 142 GG14749-PA 1..142 1..142 365 46.5 Plus
Dere\GG22912-PA 191 GG22912-PA 1..152 1..146 253 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11883-PA 156 GH11883-PA 1..156 2..157 818 99.4 Plus
Dgri\GH18926-PA 122 GH18926-PA 1..122 21..142 304 45.1 Plus
Dgri\GH21700-PA 191 GH21700-PA 1..152 1..146 254 34.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-PA 157 CG5864-PA 1..157 1..157 821 100 Plus
AP-1sigma-PC 157 CG5864-PC 1..156 1..156 761 94.9 Plus
AP-1sigma-PB 157 CG5864-PB 1..156 1..156 761 94.9 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..145 746 99.3 Plus
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 366 46.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24137-PA 157 GI24137-PA 1..157 1..157 823 99.4 Plus
Dmoj\GI10836-PA 141 GI10836-PA 3..141 4..142 361 46.8 Plus
Dmoj\GI20707-PA 191 GI20707-PA 1..152 1..146 256 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23383-PA 157 GL23383-PA 1..157 1..157 826 100 Plus
Dper\GL27163-PA 142 GL27163-PA 1..142 1..142 365 46.5 Plus
Dper\GL11643-PA 191 GL11643-PA 1..152 1..146 253 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19188-PA 157 GA19188-PA 1..157 1..157 826 100 Plus
Dpse\GA19327-PA 142 GA19327-PA 1..142 1..142 365 46.5 Plus
Dpse\GA15753-PA 191 GA15753-PA 1..152 1..146 253 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26541-PA 156 GM26541-PA 1..156 2..157 821 100 Plus
Dsec\GM15088-PA 142 GM15088-PA 1..142 1..142 365 46.5 Plus
Dsec\GM16073-PA 188 GM16073-PA 1..152 1..146 253 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21048-PA 156 GD21048-PA 1..156 2..157 821 100 Plus
Dsim\GD19995-PA 142 GD19995-PA 1..142 1..142 365 46.5 Plus
Dsim\GD11816-PA 191 GD11816-PA 1..152 1..146 253 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24652-PA 156 GJ24652-PA 1..156 2..157 818 99.4 Plus
Dvir\GJ14442-PA 142 GJ14442-PA 1..142 1..142 365 46.5 Plus
Dvir\GJ19697-PA 191 GJ19697-PA 1..152 1..146 256 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11486-PA 156 GK11486-PA 1..156 2..157 821 100 Plus
Dwil\GK12771-PA 142 GK12771-PA 1..142 1..142 365 46.5 Plus
Dwil\GK15725-PA 191 GK15725-PA 1..152 1..146 255 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23431-PA 156 GE23431-PA 1..156 2..157 821 100 Plus
Dyak\AP-2sigma-PA 142 GE25002-PA 1..142 1..142 365 46.5 Plus
Dyak\GE14351-PA 191 GE14351-PA 1..152 1..146 253 33.6 Plus

LD14109.hyp Sequence

Translation from 93 to 566

> LD14109.hyp
MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFL
EWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCE
LDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQEDETPQSF
FDDHGLG*

LD14109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-PA 157 CG5864-PA 1..157 1..157 821 100 Plus
AP-1sigma-PC 157 CG5864-PC 1..156 1..156 761 94.9 Plus
AP-1sigma-PB 157 CG5864-PB 1..156 1..156 761 94.9 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..145 746 99.3 Plus
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 366 46.5 Plus