Clone LD14505 Report

Search the DGRC for LD14505

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:145
Well:5
Vector:pBS SK-
Associated Gene/Transcriptlolal-RD
Protein status:LD14505.pep: gold
Preliminary Size:1107
Sequenced Size:910

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5738 2001-01-01 Release 2 assignment
CG5738 2001-07-04 Blastp of sequenced clone
CG5738 2003-01-01 Sim4 clustering to Release 3
lolal 2008-04-29 Release 5.5 accounting
lolal 2008-08-15 Release 5.9 accounting
lolal 2008-12-18 5.12 accounting

Clone Sequence Records

LD14505.complete Sequence

910 bp (910 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060364

> LD14505.complete
AGGTGAGTTAAGTGCGGGACAAAAAAAAAGCGTAGTGCGTCAAAGAAAAC
CCAAGCGAAAACCCACGGATTAAGCGGTCCGCTGCGAATTAAGACCATCT
AACGGTGAACCTTTCGGTCACTAGTCCAAATTAAGCCTCCTGCCCACCCC
CCTCCCAGCATTCTGTTCAGCGAGCGCGACGCCCCCACAAAACAAAAGCT
TCTTCATGATGTCGTCGGATCAACAGTTCTTTCTAAAATGGAACGATTTT
CAAACGAATATGGTGACCTCGTTCCGTCACCTGCGCGACGAGAAGAGCTT
CACAGATGTAACACTCGCCTGCGAGGGCCAAACCTGCAAAGCCCACAAAA
TGGTGCTTTCCGCTTGCAGTCCCTACTTTAAAGCGCTACTGGAGGAGAAC
CCATCGAAGCATCCGATCATTATCCTGAAAGATGTCTCCTACATTCACCT
ACAGGCTATACTGGAGTTCATGTACGCCGGTGAGGTGAACGTGTCCCAGG
AACAATTGCCAGCATTTCTTAAGACCGCCGATCGCCTCAAAGTGAAAGGC
CTCGCAGAGACACCCAGTTCGATAAAGCGGGAAGGTTGATGGTATTAAAC
AATAATCGAAACAAAAAATACATAATAAATAACAACAACCAACTATAAGA
AACTTATATGTACGCAAGAAAACAAAATTCCAACCAGCGGCAAAAGAAAC
AACATTACGAGAACGACATTTGGTATACAAATTCATATAAGAGTGCACGA
GGAGGATGAAGAACGCCAACAAATGACCACACAAAGCTAAAGCTGGACAG
ATTGAAATGATTAGCCTGTAAAGTAGAGGTGGAGGCCAAATCCGCCCGCC
CACTCCCACACCCGCTCATTCACATCTGATCAACCAAATTGCAAAAAAAA
AAAAAAAAAA

LD14505.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
lolal.c 1689 lolal.c 71..976 1..906 4530 100 Plus
lolal-RA 964 lolal-RA 71..964 1..894 4470 100 Plus
lolal.d 1712 lolal.d 131..1003 34..906 4365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14042000..14042499 892..393 2500 100 Minus
chr2R 21145070 chr2R 14043045..14043320 309..34 1365 99.6 Minus
chr2R 21145070 chr2R 14042559..14042646 395..308 440 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RH 384 CG5738-PH 1..384 206..589 1920 100 Plus
lolal-RG 384 CG5738-PG 1..384 206..589 1920 100 Plus
lolal-RF 384 CG5738-PF 1..384 206..589 1920 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RA 1686 CG5738-RA 45..936 1..892 4460 100 Plus
lolal-RH 958 CG5738-RH 98..958 32..892 4305 100 Plus
lolal-RG 1005 CG5738-RG 147..1005 34..892 4295 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-PH 127 CG5738-PH 10..127 233..586 611 100 Plus
lolal-PG 127 CG5738-PG 10..127 233..586 611 100 Plus
lolal-PF 127 CG5738-PF 10..127 233..586 611 100 Plus
lolal-PE 127 CG5738-PE 10..127 233..586 611 100 Plus
lolal-PD 127 CG5738-PD 10..127 233..586 611 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18154831..18155344 906..393 2570 100 Minus
2R 25286936 2R 18155890..18156165 309..34 1380 100 Minus
2R 25286936 2R 18155404..18155491 395..308 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18156030..18156543 906..393 2570 100 Minus
2R 25260384 2R 18157089..18157364 309..34 1380 100 Minus
2R 25260384 2R 18156603..18156690 395..308 440 100 Minus
2R 25260384 2R 18159141..18159173 33..1 165 100 Minus
Blast to na_te.dros performed 2014-11-27 15:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 498..558 643..704 118 67.7 Plus

LD14505.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:29:43 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14045097..14045129 1..33 100   Minus
chr2R 14043047..14043320 34..307 99 <- Minus
chr2R 14042560..14042646 308..394 100 <- Minus
chr2R 14042000..14042497 395..892 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:49 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RC 1..384 206..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:59:36 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RC 1..384 206..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:59 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RE 1..384 206..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:43:28 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RC 1..384 206..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:29:43 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RF 1..384 206..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:14:45 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RF 9..900 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:59:36 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RA 9..900 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:59 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RA 45..936 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:43:29 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RA 1..890 3..892 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:29:43 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RA 45..936 1..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:29:43 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18157942..18157974 1..33 100   Minus
2R 18155892..18156165 34..307 100 <- Minus
2R 18155405..18155491 308..394 100 <- Minus
2R 18154845..18155342 395..892 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:59 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14045447..14045479 1..33 100   Minus
arm_2R 14043397..14043670 34..307 100 <- Minus
arm_2R 14042910..14042996 308..394 100 <- Minus
arm_2R 14042350..14042847 395..892 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:20 Download gff for LD14505.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18159141..18159173 1..33 100   Minus
2R 18157091..18157364 34..307 100 <- Minus
2R 18156604..18156690 308..394 100 <- Minus
2R 18156044..18156541 395..892 100 <- Minus

LD14505.pep Sequence

Translation from 205 to 588

> LD14505.pep
MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMV
LSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQ
LPAFLKTADRLKVKGLAETPSSIKREG*

LD14505.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12279-PA 127 GF12279-PA 1..127 1..127 684 100 Plus
Dana\GF14766-PA 1267 GF14766-PA 71..186 3..118 390 59.5 Plus
Dana\GF10078-PA 1088 GF10078-PA 195..308 5..118 386 57.9 Plus
Dana\GF10081-PA 995 GF10081-PA 104..216 6..118 377 58.4 Plus
Dana\GF22979-PA 648 GF22979-PA 1..118 1..118 372 56.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20988-PA 127 GG20988-PA 1..127 1..127 684 100 Plus
Dere\GG14626-PA 528 GG14626-PA 100..212 6..118 389 59.3 Plus
Dere\GG14622-PA 1074 GG14622-PA 197..318 5..127 389 56.1 Plus
Dere\GG23712-PA 904 GG23712-PA 80..190 8..118 386 61.3 Plus
Dere\GG12867-PA 728 GG12867-PA 1..117 2..118 381 53.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20847-PA 127 GH20847-PA 1..127 1..127 678 98.4 Plus
Dgri\GH13387-PA 920 GH13387-PA 80..195 3..118 399 61.2 Plus
Dgri\GH15666-PA 655 GH15666-PA 207..320 5..118 387 57.9 Plus
Dgri\GH17956-PA 856 GH17956-PA 1..117 2..118 375 53 Plus
Dgri\GH15669-PA 517 GH15669-PA 118..228 8..118 371 59.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-PH 127 CG5738-PH 1..127 1..127 657 100 Plus
lolal-PG 127 CG5738-PG 1..127 1..127 657 100 Plus
lolal-PF 127 CG5738-PF 1..127 1..127 657 100 Plus
lolal-PE 127 CG5738-PE 1..127 1..127 657 100 Plus
lolal-PD 127 CG5738-PD 1..127 1..127 657 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20951-PA 127 GI20951-PA 1..127 1..127 684 100 Plus
Dmoj\GI20650-PA 894 GI20650-PA 69..180 7..118 391 61.6 Plus
Dmoj\GI12710-PA 1127 GI12710-PA 187..309 5..127 391 55.3 Plus
Dmoj\GI16491-PA 914 GI16491-PA 1..117 2..118 377 53 Plus
Dmoj\GI23126-PA 653 GI23126-PA 1..118 1..118 371 56.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10513-PA 126 GL10513-PA 1..126 2..127 678 100 Plus
Dper\GL19550-PA 895 GL19550-PA 80..190 8..118 392 62.2 Plus
Dper\GL23993-PA 415 GL23993-PA 1..118 1..118 372 56.8 Plus
Dper\GL17189-PA 680 GL17189-PA 1..117 2..118 355 53.8 Plus
Dper\GL23182-PA 258 GL23182-PA 2..115 5..118 346 53.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19096-PA 126 GA19096-PA 1..126 2..127 678 100 Plus
Dpse\GA28270-PA 592 GA28270-PA 192..316 3..127 398 54.4 Plus
Dpse\GA17171-PA 908 GA17171-PA 83..193 8..118 396 62.2 Plus
Dpse\GA22724-PA 889 GA22724-PA 1..117 2..118 372 53 Plus
Dpse\ttk-PB 640 GA14992-PB 1..118 1..118 371 56.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19923-PA 126 GM19923-PA 1..126 2..127 678 100 Plus
Dsec\GM14235-PA 575 GM14235-PA 196..316 6..127 387 56.6 Plus
Dsec\GM18962-PA 893 GM18962-PA 78..188 8..118 386 61.3 Plus
Dsec\GM14240-PA 541 GM14240-PA 100..212 6..118 371 58.4 Plus
Dsec\GM16442-PA 643 GM16442-PA 1..118 1..118 367 55.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25412-PA 127 GD25412-PA 1..127 1..127 684 100 Plus
Dsim\ab-PA 891 GD23771-PA 78..188 8..118 386 61.3 Plus
Dsim\GD13495-PA 1066 GD13495-PA 196..316 6..127 386 56.6 Plus
Dsim\ttk-PA 813 GD21596-PA 1..118 1..118 366 55.9 Plus
Dsim\lola-PA 671 GD25965-PA 59..175 2..118 355 53.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20673-PA 127 GJ20673-PA 1..127 1..127 684 100 Plus
Dvir\GJ13245-PA 872 GJ13245-PA 61..175 4..118 399 61.7 Plus
Dvir\GJ12698-PA 524 GJ12698-PA 108..220 6..118 394 59.3 Plus
Dvir\GJ12695-PA 635 GJ12695-PA 188..303 3..118 394 57.8 Plus
Dvir\GJ23100-PA 654 GJ23100-PA 4..116 6..118 370 58.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19492-PA 127 GK19492-PA 1..127 1..127 684 100 Plus
Dwil\GK14898-PA 905 GK14898-PA 89..201 6..118 395 61.9 Plus
Dwil\GK16859-PA 530 GK16859-PA 53..167 5..119 386 57.4 Plus
Dwil\GK16863-PA 1092 GK16863-PA 111..223 6..118 381 58.4 Plus
Dwil\GK18522-PA 959 GK18522-PA 1..117 2..118 376 53 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13931-PA 127 GE13931-PA 1..127 1..127 684 100 Plus
Dyak\bab1-PA 542 GE20985-PA 100..212 6..118 390 59.3 Plus
Dyak\GE20983-PA 1072 GE20983-PA 202..323 5..127 388 56.1 Plus
Dyak\ab-PA 897 GE18519-PA 78..189 7..118 386 60.7 Plus
Dyak\ttk-PA 813 GE10957-PA 1..118 1..118 372 56.8 Plus

LD14505.hyp Sequence

Translation from 205 to 588

> LD14505.hyp
MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMV
LSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQ
LPAFLKTADRLKVKGLAETPSSIKREG*

LD14505.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-PH 127 CG5738-PH 1..127 1..127 657 100 Plus
lolal-PG 127 CG5738-PG 1..127 1..127 657 100 Plus
lolal-PF 127 CG5738-PF 1..127 1..127 657 100 Plus
lolal-PE 127 CG5738-PE 1..127 1..127 657 100 Plus
lolal-PD 127 CG5738-PD 1..127 1..127 657 100 Plus