Clone LD14687 Report

Search the DGRC for LD14687

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:146
Well:87
Vector:pBS SK-
Associated Gene/TranscriptDnz1-RA
Protein status:LD14687.pep: gold
Preliminary Size:2184
Sequenced Size:1961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6627 2001-01-01 Release 2 assignment
CG6627 2001-10-10 Blastp of sequenced clone
CG6627 2003-01-01 Sim4 clustering to Release 3
Dnz1 2008-04-29 Release 5.5 accounting
Dnz1 2008-08-15 Release 5.9 accounting
Dnz1 2008-12-18 5.12 accounting

Clone Sequence Records

LD14687.complete Sequence

1961 bp (1961 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061178

> LD14687.complete
TCGCGCTTCCCGCAAACGGTCACCCTAAATAAATAAATGACAATTTCAAG
CGTAAAATAAGCCCTAAAATTTCGATGAAACGCTCGATTTGTGAATCGTG
CACCCAGCAGTGAGTGGGCAAAGTGCGGCAGCCGACGAGACCGCCACCAG
GAGCCTCGTATCCCGCCCAGCAGTGGATCGGTGGTCGCCAGACGAGCCGA
GGAACTACAGCAACAATTGTTATTTTTCGGCCCTCGATTTTCAGGGGGAG
GGGGGCTAGGAACATCAGCCCCTTCGGTTTCTAATTGAATTAAATAGAAG
GGGCGGAGAGGCAATATCACCCAGGTCAGTCCAACAAGACGCAGGCAGCA
GAGCAATGGTTTTTATCCGAGATCCCTGTGGCATCGCCTGCTTGGTAGTC
ACCTACGGAGCAGTTCTGTACGCGGACTATGTGGTCATCCGTTGGATCAT
TCTGACCACCATGCCGGGCAGCCTCTGGATGTCCTTCCATGTGGTGCTCT
TTAACACCGTCGTCTTCCTGTTGGCCATGTCCCACTCCAAGGCCGTGTTC
TCCGATCCAGGCACTGTGCCGCTGCCCGCCAATCGTCTGGACTTCTCCGA
CCTGCACACGACCAACAAAAACAATCCTCCGCCCGGTAATGGACACAGCA
GCGAATGGACCGTGTGCACCCGCTGCGAAACGTATAGGCCGCCACGCGCC
CATCATTGTCGCATCTGCAAGCGGTGCATCCGGCGCATGGATCACCACTG
CCCCTGGATCAACAACTGTGTGGGCGAGCGCAATCAGAAGTACTTCCTGC
AGTTCCTCATCTACGTGGCGCTGCTGTCGCTCTACTCCATTGCCCTTATC
GTCGGTTCCTGGGTGTGGCCCTGCGAGGAGTGCAGCCAGAACGTGATCGA
AACCCAGTTGCGAATGATTCACTCGGTTATCCTTATGCTGGTGTCGGCGC
TGTTCGGCCTGTTCGTTACGGCCATCATGGTGGACCAGCTGCATGCGATT
CTGTACGACGAGACGGCCGTGGAGGCGATACAGCAGAAGGGCACCTATCG
TCCAAATCGGCGCAAGTACCAGCTGCTGGCGGATGTGTTCGGACGCGGAC
ATCCGGCGCTGTGGCTGCTGCCCTGCACCAGTCTCAATCATGCCTCCCGC
TACCATGATACGCCTCTACTGAGCCACGAGGTCTAGGGTCAGGAAATATT
CTTTATATTTTGTCCTTGCGTTTGCTGTGCGGCTAAAAGAGCCCCCGAGT
GTTTTTAGTTTTTAATCAATGTGTGTGTGATTATTTTTAAACGACCTATC
CCCCTGCCCGCAGCCAGTCAAATTGAATCGTATTTCGTTTTGTGTATTAT
ATGCAGATTCCAACTTAATTTATGCTTTAGTTTATAATGTTTTAAAATTA
TAAATACATAGAAAGCAGCAGCGTGGCGGCCAACAGGAGCATACTCAAAA
TGAACACGGCTATTTTGTAAGTAACTTTTTGCAGCTGCTTGCTTTAGAAT
GCCAGCGAATGTTGCGTTGATTATTTGTACACCGATGCATTCTTTGGCCA
CCCGGTGTATTTTTTACCAGTATCCAAGTAAGCAGCACCTTCTAGTTTGA
GACGTAGAAAAATCTCAACTGTATACAATACTACATAGCAATATGTACCG
AGCTAGAAACTAAGTCCTTATCAAAAGCATTTACGATATACCCGAAGAAT
GACGCATATACCAAAAAGGAAATAAAACGGAGATTAAACACTCAAATAGA
AAATACTGTGCATCATTAGTTTGTAATAATTGTAATCACTGTTTAGTTTT
GTAGTTTATTGTTCTTTTGACATTTACGACCATCGACCAGCGCACCAATA
AGATTTTAAATGTAACACCAACATCAGCAGTTTGTGTCCCTAGAAACCCA
GAACTGTTCCCAATAAAGCTAACCGATATGCATAAGTCAAAAAAAAAAAA
AAAAAAAAAAA

LD14687.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 2034 Dnz1-RA 60..1999 1..1940 9700 100 Plus
CG17086-RA 1760 CG17086-RA 1589..1760 1940..1769 860 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10853205..10854227 1938..916 5115 100 Minus
chr2L 23010047 chr2L 10854933..10855403 471..1 2295 99.2 Minus
chr2L 23010047 chr2L 10854424..10854871 916..469 2195 99.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 831 CG6627-PA 1..831 356..1186 4155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:01:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 1949 CG6627-RA 12..1949 1..1938 9690 100 Plus
CG43129-RE 2417 CG43129-RE 2248..2417 1938..1769 850 100 Minus
CG43129-RD 1703 CG43129-RD 1534..1703 1938..1769 850 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-PA 276 CG6627-PA 1..276 356..1183 1346 100 Plus
CG8314-PA 293 CG8314-PA 33..287 365..1156 338 32.2 Plus
CG34449-PC 500 CG34449-PC 49..247 509..1111 175 28.5 Plus
CG34449-PD 523 CG34449-PD 49..247 509..1111 175 28.5 Plus
CG1407-PB 338 CG1407-PB 10..292 368..1132 172 24 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10854433..10855457 1940..916 5125 100 Minus
2L 23513712 2L 10856163..10856633 471..1 2355 100 Minus
2L 23513712 2L 10855654..10856101 916..469 2240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10854433..10855457 1940..916 5125 100 Minus
2L 23513712 2L 10856163..10856633 471..1 2355 100 Minus
2L 23513712 2L 10855654..10856101 916..469 2240 100 Minus
Blast to na_te.dros performed 2014-11-26 23:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 793..840 1817..1770 114 70.8 Minus

LD14687.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:18:34 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10854933..10855403 1..471 99   Minus
chr2L 10854425..10854868 472..915 99 <- Minus
chr2L 10853205..10854227 916..1938 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:48:59 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 356..1186 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:56 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 356..1186 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:15:32 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 356..1186 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:15:43 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 356..1186 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:34 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 356..1186 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:30:35 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 37..1974 1..1938 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:55 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 37..1974 1..1938 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:15:32 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 12..1949 1..1938 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:15:43 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 37..1974 1..1938 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:34 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 12..1949 1..1938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:18:34 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10856163..10856633 1..471 100   Minus
2L 10855655..10856098 472..915 100 <- Minus
2L 10854435..10855457 916..1938 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:15:32 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10856163..10856633 1..471 100   Minus
arm_2L 10855655..10856098 472..915 100 <- Minus
arm_2L 10854435..10855457 916..1938 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:32 Download gff for LD14687.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10856163..10856633 1..471 100   Minus
2L 10855655..10856098 472..915 100 <- Minus
2L 10854435..10855457 916..1938 100 <- Minus

LD14687.pep Sequence

Translation from 355 to 1185

> LD14687.pep
MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFN
TVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSE
WTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQF
LIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALF
GLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHP
ALWLLPCTSLNHASRYHDTPLLSHEV*

LD14687.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14058-PA 275 GF14058-PA 1..275 1..276 1409 94.9 Plus
Dana\GF13331-PA 295 GF13331-PA 35..281 4..259 414 32.8 Plus
Dana\GF20610-PA 239 GF20610-PA 45..162 39..165 272 37.8 Plus
Dana\GF12009-PA 338 GF12009-PA 10..300 5..266 235 24.1 Plus
Dana\GF24992-PA 740 GF24992-PA 65..262 46..231 233 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10348-PA 276 GG10348-PA 1..276 1..276 1477 99.6 Plus
Dere\GG22313-PA 293 GG22313-PA 33..288 4..268 422 32.1 Plus
Dere\GG13843-PA 745 GG13843-PA 65..194 46..160 229 32.3 Plus
Dere\GG18872-PA 428 GG18872-PA 18..234 23..235 226 28.9 Plus
Dere\GG25240-PA 438 GG25240-PA 10..289 5..259 226 25.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13330-PA 278 GH13330-PA 1..278 1..276 1335 88.1 Plus
Dgri\GH19831-PA 290 GH19831-PA 28..285 4..268 406 31.6 Plus
Dgri\GH16078-PA 741 GH16078-PA 65..262 46..231 235 28.6 Plus
Dgri\GH20289-PA 470 GH20289-PA 11..287 5..256 234 25.8 Plus
Dgri\GH13870-PA 419 GH13870-PA 22..234 27..235 220 28.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-PA 276 CG6627-PA 1..276 1..276 1504 100 Plus
CG8314-PA 293 CG8314-PA 33..287 4..267 424 32.2 Plus
CG1407-PB 338 CG1407-PB 10..292 5..259 250 25.1 Plus
CG1407-PD 352 CG1407-PD 10..292 5..259 250 25.1 Plus
CG1407-PA 443 CG1407-PA 10..292 5..259 250 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17805-PA 277 GI17805-PA 1..277 1..276 1306 86.3 Plus
Dmoj\GI17806-PA 265 GI17806-PA 1..265 1..276 956 65.2 Plus
Dmoj\GI20419-PA 290 GI20419-PA 28..276 4..259 409 32.3 Plus
Dmoj\GI12340-PA 735 GI12340-PA 37..221 10..196 233 28.5 Plus
Dmoj\GI23298-PA 381 GI23298-PA 121..197 86..162 228 46.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19029-PA 275 GL19029-PA 1..275 1..276 1397 94.2 Plus
Dper\GL20650-PA 286 GL20650-PA 26..280 4..267 423 31.9 Plus
Dper\GL25005-PA 267 GL25005-PA 80..241 50..196 235 30.1 Plus
Dper\GL17257-PA 341 GL17257-PA 52..253 13..193 222 29.7 Plus
Dper\GL23902-PA 381 GL23902-PA 69..197 9..162 221 32.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19735-PA 275 GA19735-PA 1..275 1..276 1397 94.2 Plus
Dpse\GA20978-PA 286 GA20978-PA 26..280 4..267 423 31.9 Plus
Dpse\GA19011-PA 820 GA19011-PA 76..273 46..231 234 28.6 Plus
Dpse\GA18728-PA 426 GA18728-PA 22..231 27..232 226 27.6 Plus
Dpse\GA27100-PA 381 GA27100-PA 69..197 9..162 221 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11347-PA 276 GM11347-PA 1..276 1..276 1482 100 Plus
Dsec\GM20103-PA 293 GM20103-PA 33..288 4..268 421 32.1 Plus
Dsec\GM24887-PA 435 GM24887-PA 82..234 92..234 228 35.5 Plus
Dsec\GM24028-PA 427 GM24028-PA 22..234 27..235 226 28.5 Plus
Dsec\GM20560-PA 440 GM20560-PA 10..289 5..259 226 24.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22217-PA 276 GD22217-PA 1..276 1..276 1482 100 Plus
Dsim\GD25579-PA 293 GD25579-PA 33..288 4..268 422 32.1 Plus
Dsim\GD12736-PA 744 GD12736-PA 65..194 46..160 229 32.3 Plus
Dsim\GD26013-PA 440 GD26013-PA 10..289 5..259 226 24.7 Plus
Dsim\GD18828-PA 427 GD18828-PA 22..234 27..235 226 28.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17630-PA 277 GJ17630-PA 1..277 1..276 1311 87 Plus
Dvir\GJ20091-PA 289 GJ20091-PA 27..275 4..259 420 33.6 Plus
Dvir\GJ21210-PA 480 GJ21210-PA 10..286 5..256 233 25.1 Plus
Dvir\GJ24153-PA 382 GJ24153-PA 121..197 86..162 232 48.1 Plus
Dvir\GJ12670-PA 421 GJ12670-PA 45..232 43..232 230 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18372-PA 275 GK18372-PA 1..275 1..276 1363 90.9 Plus
Dwil\GK22100-PA 291 GK22100-PA 31..277 4..259 414 33 Plus
Dwil\GK24311-PA 391 GK24311-PA 89..228 103..232 243 36.6 Plus
Dwil\GK21953-PA 367 GK21953-PA 10..285 5..256 237 24.5 Plus
Dwil\GK16977-PA 781 GK16977-PA 76..240 46..196 233 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13229-PA 276 GE13229-PA 1..276 1..276 1482 100 Plus
Dyak\GE14111-PA 293 GE14111-PA 33..288 4..268 420 32.1 Plus
Dyak\GE21257-PA 441 GE21257-PA 36..234 39..234 234 29.6 Plus
Dyak\GE20136-PA 743 GE20136-PA 65..194 46..160 229 32.3 Plus
Dyak\GE26189-PA 428 GE26189-PA 18..234 23..235 224 28.4 Plus

LD14687.hyp Sequence

Translation from 355 to 1185

> LD14687.hyp
MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFN
TVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSE
WTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQF
LIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALF
GLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHP
ALWLLPCTSLNHASRYHDTPLLSHEV*

LD14687.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-PA 276 CG6627-PA 1..276 1..276 1504 100 Plus
CG8314-PA 293 CG8314-PA 33..287 4..267 424 32.2 Plus
CG1407-PB 338 CG1407-PB 10..292 5..259 250 25.1 Plus
CG1407-PD 352 CG1407-PD 10..292 5..259 250 25.1 Plus
CG1407-PA 443 CG1407-PA 10..292 5..259 250 25.1 Plus