Clone LD14822 Report

Search the DGRC for LD14822

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:148
Well:22
Vector:pBS SK-
Associated Gene/TranscriptCG8679-RA
Protein status:LD14822.pep: gold
Sequenced Size:2548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8679 2003-01-01 Sim4 clustering to Release 3
CG8679 2004-10-22 Blastp of sequenced clone
CG8679 2008-04-29 Release 5.5 accounting
CG8679 2008-08-15 Release 5.9 accounting
CG8679 2008-12-18 5.12 accounting

Clone Sequence Records

LD14822.complete Sequence

2548 bp (2548 high quality bases) assembled on 2004-10-22

GenBank Submission: BT016107

> LD14822.complete
ATGCGGCACCGCTGACATTGAAAAGGCGAGAATTAAGCGATAATTGATTG
CAGTTTGAAATAGGAGCGAGAGAGTGCATGGGTAAAAATCAATACAGGGA
GCACGCCGATGGAGCAGCGCGCCAACTTTCTGGCTCTGACCCTCCTGGAC
GCCCTGGAGGACGAGAACGAGGCTGATATAATGTCGATGCTGGAGAGGAA
CAGCATAAATGCTGGCATCGTGCCCTGCGATCGAGGACTGGCTCCCTTGC
ACTACGTGTGCGGCATGCGAAACGGGGGACTGGCCCAGCGAATCCTGGAG
CGGTTTCTCGAGTGCCCCGACCTCGACGTGAATGCCTTGTGCGACGGCCA
GACCACGGCGCTGCACATCGCTAGCATTTATGGGCGGACGGAACTGGTTA
GGATGCTGCTGGAGCGCGGAGCTTGCGCGGACCTGGCTGATGAGGATAAT
AAGCTGCCAGTTCACTACGCCATTGAAGAGTGCCACTTTGAGGTGCTGCA
GCTGCTCCGGGATCACATCTTCCGCGAGAGGCAGATCCAGAAAAAGCAGC
AACAGCGAGTCCAGGTGGTTGACGCTCTAACCCCCAATCAGCCTAGGTAC
AATCACGATGTAACTTCCCCGTACTATATTAATATCACTCACAGGCGGCA
TCGACCGCAGCCGAAGTTTCCGGAGCCAACGGAGGTGGAGTGCGCCGACA
TTCCACCCCTGCCCGATGAGGAGTCTGTGAACCTGTTTGCCCTCACTGAA
GCTCACCTTACCCAACTCATCCAGAGCCAACGGCAGAACCAGCCGGAAGA
TCCTTGTCAGCCAAAGCGGCGAACTCTTATTGAAAGCTGGCGTGAGAAGG
TGGAACGCTCGCGCGCCCGCCAGTCCCTGTTCCATCAGTACGATGAGCAT
GTGGAAGCGATGGTGGATGATGCTATTAGTCAGGAGGACTTCAACTATAA
GGAGCACCTGCAGAAAAAGCTCAGAGACGAGGACAATTCGAAGAATCTGA
CAGAGGATGCACCCAACTCGGGTCGTCAGGTGTTCGAGATGCTAGTGGAG
CAAGTCTCTCAGGCTGTCGTCGTGGAGCCGGAACCGGAGCACAGTTTCTT
TACAGCTCAGGGCGACGAGGTGGACGTGGCGGAGAGCTCAGCACGCCAGG
ATGAGTACTTTCTGCAAATCAAGGAGGCCTACGTTCACACCGACGACGAG
AATGGGTTAGTTTTCTACGAAGCGAGATACCTACAAAACAGGGACAGGCG
GGAGCCAGTCGAGCAAACTCCCAAAGAGAGGAAGCACGATTTGGAAAGCT
CCGTGAGCACTAATTATACCCTGCCACTTGACTACGAAACGGACGCCCTG
CGCCGGGAGTTGACACAGCTAGGGGCTCCGGTGGGTCCCATTACCAAAAC
AACTAAGCGGCTGTACATCAAGCAGCTAATCAAATACAAGCGCAATACGG
AGGCGCTGCTGGCCGCCCAAAAACACGCCCAGGATGCGCAGATCCGATAC
TCGGTAGAGCTTCATCGCACGCTGCGGTCGCCAGAGGACTTTGCGAGGAT
CAATGATTACTTGCCGCATGAAGCAACCTCTGCAGCGCATTTCGCACAGT
GTGGGGTGACAAAAAAGAACATGCGAGAGGGGCACCTTAAACAGAGCTTC
ATCTACATGTTGATTGATCCACGCATTTCTCGGAATCTGCCTGGGGAGAG
CGCTTTTCTCGAAAAGTTCGGGGTTTGGCAGCGTTTTCTGGACTCCATTT
TTTACATAGGCAAGGGTAAATGTTCGCGACCGTACGCTCACCTTTACGAT
GCCATGCGGCAGCACACACGCCTTCACCAGAAGCGCGAAAAAGATAAGAC
AAATAGGGAACGCGGCGGCGGATTCCGCACCCTACAGCCAGATGTTTTCC
GCTCCCCTCCACCGGGAGATGGAAAGATGGGAAGCCGTAAGCTGGAGCGC
ATCCTGGACATTTGGCAACATGGCAGTGGAGTCGTATGTCTTCATGTCTT
TCACAACATCTTGCCAATTGATGCATACACACGCGAAGCTTCCATTATAG
ACGCTCTGGGCTTGAATCACCTTACCAATATAAAGCGCGGCGACTACTAT
GGGCCGGCTCAGTCTTGGACCATGAAACAGAAAAAGCAACTGGGAATAGC
GCTGCTTTTCAAGGCCATGCACATCTATCTGGCGGAGGGAGAATCACAGT
TGTCGCCAAGCGACCTCCTCTGAGAACGGGAATAAAATGTGGAAAAAATA
TTTACCATTATTACAAAGTGGAACGGCGCATCTCGAATATGTTCAAAGAT
TGATCTCAAGATTAATTTTATTTAGAAAATGGGCAGAATAAAAAAATTGG
GAAATAAGTAAGGCTATTGAATTCAAGGCAACAGTTTACAAATTTAATTC
TAGCTGGACCATTAGCGGTAGCATTTTAAATGATGAGATGATTTACAAAA
TATTATTATATTAATTTTTAGTCAAATAGTTATGCAATTTGGACAGATTA
ATTTCAAATAATAAAATACGTCCATTCAAAAAAAAAAAAAAAAAAAAA

LD14822.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-RA 2220 CG8679-RA 1..2220 4..2223 11100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21214536..21217062 2527..1 12620 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-RA 2115 CG8679-PA 1..2115 109..2223 10575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-RA 2541 CG8679-RA 15..2541 1..2527 12635 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-PA 704 CG8679-PA 1..704 109..2220 3528 100 Plus
CG42391-PA 253 CG42391-PA 22..243 1420..2208 343 35 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21216001..21218530 2530..1 12650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21216001..21218530 2530..1 12650 100 Minus
Blast to na_te.dros performed 2014-11-26 23:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 3..85 2500..2419 115 61.4 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7041..7123 2500..2419 115 61.4 Minus

LD14822.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:18:43 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21214536..21217062 1..2527 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:11 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2115 109..2223 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:30:12 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2115 109..2223 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:15:40 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2115 109..2223 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:14:07 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2115 109..2223 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:43 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2115 109..2223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:34:30 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2220 4..2223 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:30:11 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2524 4..2527 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:15:40 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 15..2541 1..2527 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:14:07 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 1..2220 4..2223 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:43 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
CG8679-RA 15..2541 1..2527 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:18:43 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21216004..21218530 1..2527 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:15:40 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21216004..21218530 1..2527 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:50:51 Download gff for LD14822.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21216004..21218530 1..2527 100   Minus

LD14822.pep Sequence

Translation from 108 to 2222

> LD14822.pep
MEQRANFLALTLLDALEDENEADIMSMLERNSINAGIVPCDRGLAPLHYV
CGMRNGGLAQRILERFLECPDLDVNALCDGQTTALHIASIYGRTELVRML
LERGACADLADEDNKLPVHYAIEECHFEVLQLLRDHIFRERQIQKKQQQR
VQVVDALTPNQPRYNHDVTSPYYINITHRRHRPQPKFPEPTEVECADIPP
LPDEESVNLFALTEAHLTQLIQSQRQNQPEDPCQPKRRTLIESWREKVER
SRARQSLFHQYDEHVEAMVDDAISQEDFNYKEHLQKKLRDEDNSKNLTED
APNSGRQVFEMLVEQVSQAVVVEPEPEHSFFTAQGDEVDVAESSARQDEY
FLQIKEAYVHTDDENGLVFYEARYLQNRDRREPVEQTPKERKHDLESSVS
TNYTLPLDYETDALRRELTQLGAPVGPITKTTKRLYIKQLIKYKRNTEAL
LAAQKHAQDAQIRYSVELHRTLRSPEDFARINDYLPHEATSAAHFAQCGV
TKKNMREGHLKQSFIYMLIDPRISRNLPGESAFLEKFGVWQRFLDSIFYI
GKGKCSRPYAHLYDAMRQHTRLHQKREKDKTNRERGGGFRTLQPDVFRSP
PPGDGKMGSRKLERILDIWQHGSGVVCLHVFHNILPIDAYTREASIIDAL
GLNHLTNIKRGDYYGPAQSWTMKQKKQLGIALLFKAMHIYLAEGESQLSP
SDLL*

LD14822.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 12:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15569-PA 694 GF15569-PA 1..694 1..704 2980 80.4 Plus
Dana\GF12314-PA 713 GF12314-PA 219..377 514..700 319 41.5 Plus
Dana\GF23392-PA 1577 GF23392-PA 207..315 19..133 159 33.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11032-PA 692 GH11032-PA 1..692 1..704 2214 64.2 Plus
Dgri\GH21113-PA 636 GH21113-PA 129..303 443..657 254 32.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-PA 704 CG8679-PA 1..704 1..704 3700 100 Plus
CG42391-PA 253 CG42391-PA 22..243 438..700 343 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 12:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17551-PA 635 GI17551-PA 106..635 182..704 1623 61.3 Plus
Dmoj\GI17551-PA 635 GI17551-PA 1..137 1..137 455 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 12:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26365-PA 713 GL26365-PA 1..713 1..704 2833 74.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 12:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21257-PB 713 GA21257-PB 1..713 1..704 2823 74.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 12:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21643-PA 549 GD21643-PA 1..35 1..35 166 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 12:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15531-PA 678 GJ15531-PA 1..678 1..704 2175 65.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 12:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14681-PA 729 GK14681-PA 1..729 1..704 2325 63.9 Plus

LD14822.hyp Sequence

Translation from 108 to 2222

> LD14822.hyp
MEQRANFLALTLLDALEDENEADIMSMLERNSINAGIVPCDRGLAPLHYV
CGMRNGGLAQRILERFLECPDLDVNALCDGQTTALHIASIYGRTELVRML
LERGACADLADEDNKLPVHYAIEECHFEVLQLLRDHIFRERQIQKKQQQR
VQVVDALTPNQPRYNHDVTSPYYINITHRRHRPQPKFPEPTEVECADIPP
LPDEESVNLFALTEAHLTQLIQSQRQNQPEDPCQPKRRTLIESWREKVER
SRARQSLFHQYDEHVEAMVDDAISQEDFNYKEHLQKKLRDEDNSKNLTED
APNSGRQVFEMLVEQVSQAVVVEPEPEHSFFTAQGDEVDVAESSARQDEY
FLQIKEAYVHTDDENGLVFYEARYLQNRDRREPVEQTPKERKHDLESSVS
TNYTLPLDYETDALRRELTQLGAPVGPITKTTKRLYIKQLIKYKRNTEAL
LAAQKHAQDAQIRYSVELHRTLRSPEDFARINDYLPHEATSAAHFAQCGV
TKKNMREGHLKQSFIYMLIDPRISRNLPGESAFLEKFGVWQRFLDSIFYI
GKGKCSRPYAHLYDAMRQHTRLHQKREKDKTNRERGGGFRTLQPDVFRSP
PPGDGKMGSRKLERILDIWQHGSGVVCLHVFHNILPIDAYTREASIIDAL
GLNHLTNIKRGDYYGPAQSWTMKQKKQLGIALLFKAMHIYLAEGESQLSP
SDLL*

LD14822.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8679-PA 704 CG8679-PA 1..704 1..704 3700 100 Plus
CG42391-PA 253 CG42391-PA 22..243 438..700 343 35 Plus