Clone LD15174 Report

Search the DGRC for LD15174

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:151
Well:74
Vector:pBS SK-
Associated Gene/TranscriptCG6201-RA
Protein status:LD15174.pep: gold
Preliminary Size:1186
Sequenced Size:2329

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6201 2001-01-01 Release 2 assignment
CG6201 2003-01-01 Sim4 clustering to Release 3
CG6201 2003-04-25 Blastp of sequenced clone
CG6201 2008-04-29 Release 5.5 accounting
CG6201 2008-08-15 Release 5.9 accounting
CG6201 2008-12-18 5.12 accounting

Clone Sequence Records

LD15174.complete Sequence

2329 bp (2329 high quality bases) assembled on 2003-04-25

GenBank Submission: BT010063

> LD15174.complete
AAGGTGAGAGAGCCACTCTTATCAGCAGCGGCATCGACAAATCGAAGACA
AAACAAAACCCGTCATTAATCCCGCAGAGAAAGTCGAGCGAATCGCTCAT
CGCACGGAATGCTGTCGCTACTCCTGGTTCTGACGACGCTTGCCAGGATC
CACGCCCACTACACGAGCGGAGATGTGGTCTATCACACAATGCCGCACTT
TTGGACGGGCGTGGGCTTCTGTCCCGCCGGACGCATTGATCACGAGGGGA
TTAGCGCCGCCCTGGGCGATCCAGCCCTTCGACTTAATCTTCGCCTGATT
GCAGCATTGCCCGTGGGCGCGGTGACCCACATTCGCATCCACTGGCTGCT
GGAGCTGATACAATTCTGGCAGTACGACCCCAGCGGAATACCGATTTATG
ATTTTTCCAAGTTCGATGACTTCATTGATTTCCTACACGAGGAACTGCGC
TTGTCCCCCGTTCTGGAGTGGATGGGCAATCTGGGTGGGGTTTTTTCGGA
AAACCCCATGCAGCAATCCTTCTACTGGGAGCACTTGGTTAAGACCACGA
TTAACCACCAGATAGCACGACACGGTTCCTCCAGATTGGTCAACTGGCGC
TATGAGACATGGAATGAACCGGACCTTCGTGGGTATAACAAGCAAAACTT
TACGGCACACACCTTTCTGGATTACGTTCAAGCTGTGCGGCGGGGTTTGA
GTAAAGCTGGAAACCTGGACAACCAGGACGGAAAGGTTCCACTGCCCATG
TATCGCTCCCTGCGCGGCCCTGCAGGACTCTTTAAGGACTCGAATCATCC
GCTCTGCTGGAATCTATTGGAGCTATGCAGTCAAAGAGTGGTTTACTGTC
CCATCGACATACTGACTTTCCACCGAAAGGGAATCGAAGGCACTGCCACG
GAAATCGTAAATGGTTCGCTTTCCTTGATGGCCAAAATCTATGAGGAGTA
TCCCAATCTCAAGCAGCTGCCGGTGGCCAATGATGAAGCCGATCCTGTGG
CCGGTTGGAGCACCTCCCGGGATTTTCAGGCGGATGTGCGGTATGGAATC
ACACTGATATCTACGGTAATGCAGTTCTGGCATGCCAAGCTGGCCGGTGG
TCCACTGAGTCGCTTGGAGTCGATTAGTCATGACAACGCCTTCCTGAGCT
ACCATCCCCACGAGTTCACACAGCGCACCCTTCTAGCCCACTTCAGGATG
AACGAAACCAAACCACCGCACTCGCAGCTCGTTCAGAAACCCGTATACGC
TGCTCTGGGAATGCTGGCGAAGCTGGGCACCCGGGCTGCGGACGTGGAAA
TGGTTAATATGGATACTAAACATAGCGTCCAGGTCCTGCGTACAGTATCC
GGTGGATTAGGCGGTCCTGGTCAGTATATGGCCACAATATTTCTGAGTCC
CGAGGAGGCGGGTCCAAAGATGACAGCCTTTCATCACAAGTACACGCTAA
ACATGTCGATAGCGAATGAGTCGGCCTTCGTCACCGAGCTCCTGGTGCCA
AAGGAAACGGATCCGTACTACATATGGCAGCAAGCTGGAAGTCCGGCTTA
TCCCAACGCCACTCTAAGGGAAGCGATGCGAAGAGCCCAAGCACCTAGAC
TCTACAAGACGGGACCCATCTGGCAGTACAACAGCGAGCTAGTTATCAAC
TCCGCCAGCATCCCACTGCCCTGGGCGATGCTGCTCCGGGTGTGTTCCGC
ATCTTGGCCCAAACTGCGACGACCGCAGCAACTTTCCATCGCAGAGGTGA
CTCAGCGTGAGGTGTTCATTAGCTGGATGGAACACCCCAAATCCACGCAG
TGCCTTCTCAGCTACGAGGTGTGGTTTAAGGAACGCGATAATCTGGGTCG
CTCCGCCGACTGGATGCTCATCTCACAGGGCTGGCATCTGCCATATCCGT
CGTTTCAGTATGCGCCCGGCGATAAGGGATCCGTCAATGGTTTCTATAAA
GTTCGCGGTGTGGATGTGTTTAATGAAACCAGTCCCTACTCACAAATAGT
CGAATATCTGGAGTTGTAGTTCAACAAACAGTTTATAAATCAAAAGAAAA
TATTTATGCAATGTGAAAGCTAACATAATCAGGTTTCGGCTAGGCGCTAG
TGGACCGATCCTACTCTCAATCTGTCTCTCTTGGAATGGACTGACTTCAC
CGGCACAATCTTCTGGACTTGCGCCTTCGCCTTAACGCCGGCAATATCAT
ATATACATATATTATTTATATATAAAGATATTTATAGTACATTATATGTG
TTGTGTTCGTAATATATAAATGCCTTCTTCCTGCGAAGGAATCGGCAAAA
GCGTAAAAAAAAAAAAAAAAAAAAAAAAA

LD15174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-RA 2456 CG6201-RA 153..2456 1..2304 11520 100 Plus
CG6201.a 2264 CG6201.a 36..2264 76..2304 11145 100 Plus
l(2)gd1.a 3107 l(2)gd1.a 2780..3107 2305..1978 1640 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11109732..11110689 1941..984 4790 100 Minus
chr2L 23010047 chr2L 11111247..11111811 565..1 2825 100 Minus
chr2L 23010047 chr2L 11110768..11111187 983..564 2100 100 Minus
chr2L 23010047 chr2L 11109311..11109676 2304..1939 1830 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-RA 1911 CG6201-PA 1..1911 109..2019 9555 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-RA 2308 CG6201-RA 5..2308 1..2304 11520 100 Plus
l(2)gd1-RB 3043 CG4713-RB 2749..3043 2304..2010 1475 100 Minus
l(2)gd1-RA 2989 CG4713-RA 2695..2989 2304..2010 1475 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-PA 636 CG6201-PA 12..636 142..2016 3301 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11110978..11111935 1941..984 4790 100 Minus
2L 23513712 2L 11112493..11113057 565..1 2825 100 Minus
2L 23513712 2L 11112014..11112433 983..564 2100 100 Minus
2L 23513712 2L 11110556..11110922 2305..1939 1835 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11110978..11111935 1941..984 4790 100 Minus
2L 23513712 2L 11112493..11113057 565..1 2825 100 Minus
2L 23513712 2L 11112014..11112433 983..564 2100 100 Minus
2L 23513712 2L 11110556..11110922 2305..1939 1835 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:57:00 has no hits.

LD15174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:26:20 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11111247..11111811 1..565 100   Minus
chr2L 11110768..11111185 566..983 100 <- Minus
chr2L 11109734..11110689 984..1939 100 <- Minus
chr2L 11109422..11109675 1940..2193 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:49:38 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 1..1911 109..2019 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:45 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 1..1911 109..2019 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 1..1911 109..2019 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:13 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 1..1911 109..2019 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:20 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 1..1911 109..2019 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:55:31 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 7..2310 1..2304 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:45 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 7..2310 1..2304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:16 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 5..2308 1..2304 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:13 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 7..2310 1..2304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:20 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 5..2308 1..2304 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:26:20 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11112493..11113057 1..565 100   Minus
2L 11112014..11112431 566..983 100 <- Minus
2L 11110980..11111935 984..1939 100 <- Minus
2L 11110557..11110921 1940..2304 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:16 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11112493..11113057 1..565 100   Minus
arm_2L 11112014..11112431 566..983 100 <- Minus
arm_2L 11110980..11111935 984..1939 100 <- Minus
arm_2L 11110557..11110921 1940..2304 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:14 Download gff for LD15174.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11112493..11113057 1..565 100   Minus
2L 11112014..11112431 566..983 100 <- Minus
2L 11110980..11111935 984..1939 100 <- Minus
2L 11110557..11110921 1940..2304 100 <- Minus

LD15174.pep Sequence

Translation from 108 to 2018

> LD15174.pep
MLSLLLVLTTLARIHAHYTSGDVVYHTMPHFWTGVGFCPAGRIDHEGISA
ALGDPALRLNLRLIAALPVGAVTHIRIHWLLELIQFWQYDPSGIPIYDFS
KFDDFIDFLHEELRLSPVLEWMGNLGGVFSENPMQQSFYWEHLVKTTINH
QIARHGSSRLVNWRYETWNEPDLRGYNKQNFTAHTFLDYVQAVRRGLSKA
GNLDNQDGKVPLPMYRSLRGPAGLFKDSNHPLCWNLLELCSQRVVYCPID
ILTFHRKGIEGTATEIVNGSLSLMAKIYEEYPNLKQLPVANDEADPVAGW
STSRDFQADVRYGITLISTVMQFWHAKLAGGPLSRLESISHDNAFLSYHP
HEFTQRTLLAHFRMNETKPPHSQLVQKPVYAALGMLAKLGTRAADVEMVN
MDTKHSVQVLRTVSGGLGGPGQYMATIFLSPEEAGPKMTAFHHKYTLNMS
IANESAFVTELLVPKETDPYYIWQQAGSPAYPNATLREAMRRAQAPRLYK
TGPIWQYNSELVINSASIPLPWAMLLRVCSASWPKLRRPQQLSIAEVTQR
EVFISWMEHPKSTQCLLSYEVWFKERDNLGRSADWMLISQGWHLPYPSFQ
YAPGDKGSVNGFYKVRGVDVFNETSPYSQIVEYLEL*

LD15174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 12:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14229-PA 638 GF14229-PA 1..638 1..636 2786 79.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 12:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10327-PA 636 GG10327-PA 1..636 1..636 3331 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 12:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11437-PA 633 GH11437-PA 20..633 15..636 2536 74.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-PA 636 CG6201-PA 1..636 1..636 3412 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 12:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14757-PA 627 GI14757-PA 17..627 15..636 2482 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 12:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18590-PA 647 GL18590-PA 24..647 12..636 2788 81.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 12:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19435-PA 647 GA19435-PA 24..647 12..636 2792 81.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 12:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11156-PA 636 GM11156-PA 12..636 12..636 3318 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 12:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22194-PA 636 GD22194-PA 12..636 12..636 3324 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 12:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17170-PA 637 GJ17170-PA 24..637 15..636 2528 74.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 12:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18445-PA 640 GK18445-PA 7..640 5..636 2646 76.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 12:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13010-PA 636 GE13010-PA 12..636 12..636 3281 96.5 Plus

LD15174.hyp Sequence

Translation from 108 to 2018

> LD15174.hyp
MLSLLLVLTTLARIHAHYTSGDVVYHTMPHFWTGVGFCPAGRIDHEGISA
ALGDPALRLNLRLIAALPVGAVTHIRIHWLLELIQFWQYDPSGIPIYDFS
KFDDFIDFLHEELRLSPVLEWMGNLGGVFSENPMQQSFYWEHLVKTTINH
QIARHGSSRLVNWRYETWNEPDLRGYNKQNFTAHTFLDYVQAVRRGLSKA
GNLDNQDGKVPLPMYRSLRGPAGLFKDSNHPLCWNLLELCSQRVVYCPID
ILTFHRKGIEGTATEIVNGSLSLMAKIYEEYPNLKQLPVANDEADPVAGW
STSRDFQADVRYGITLISTVMQFWHAKLAGGPLSRLESISHDNAFLSYHP
HEFTQRTLLAHFRMNETKPPHSQLVQKPVYAALGMLAKLGTRAADVEMVN
MDTKHSVQVLRTVSGGLGGPGQYMATIFLSPEEAGPKMTAFHHKYTLNMS
IANESAFVTELLVPKETDPYYIWQQAGSPAYPNATLREAMRRAQAPRLYK
TGPIWQYNSELVINSASIPLPWAMLLRVCSASWPKLRRPQQLSIAEVTQR
EVFISWMEHPKSTQCLLSYEVWFKERDNLGRSADWMLISQGWHLPYPSFQ
YAPGDKGSVNGFYKVRGVDVFNETSPYSQIVEYLEL*

LD15174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-PA 636 CG6201-PA 1..636 1..636 3412 100 Plus