Clone LD15350 Report

Search the DGRC for LD15350

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:153
Well:50
Vector:pBS SK-
Associated Gene/Transcriptbowl-RA
Protein status:LD15350.pep: gold
Preliminary Size:3845
Sequenced Size:3659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10021 2001-01-01 Release 2 assignment
CG10021 2003-01-01 Sim4 clustering to Release 3
CG10021 2003-08-12 Blastp of sequenced clone
bowl 2008-04-29 Release 5.5 accounting
bowl 2008-08-15 Release 5.9 accounting
bowl 2008-12-18 5.12 accounting

Clone Sequence Records

LD15350.complete Sequence

3659 bp (3659 high quality bases) assembled on 2003-08-12

GenBank Submission: BT010294

> LD15350.complete
CACATTTCAGCTGCCGTGTATCTCTCGTTCTCGTTCGGTTTTCAGTTCGT
TGAGGTTGAGGTTTCGGTTCGGGTTTTTCTTCGTTCGGTTTTCATATCTG
TGAGATACAAATACATCGTGTGTTTGTGCGCGAGTTGTACGTGGATTTTG
GAAGGAAAAAAACTACGTGGTTTGTGGTAGCTGACTGCCGTTGATGCTGC
TGCTGCTCCCGTAACCGCCCCCCTGCCGCCCCCTCAGCCCCACCCCCTGG
GGCGATCGTGCCGTGATTTGAATCTCAAAATTGTCCCTTAGTAATCGTAT
TAACAGAAGTCTTCAAACAAATACAACAAGAAAAAACAACATACAATTCA
AGTGCCACTTAAATGATATAAATTACTACTTTAAAAACCAAAAACAATGC
CAAGCATTTCAAAGCTTACAAACTGACAAAAAACCAGCAAAATCATATTG
AAACAACTACTTGGATACTTTAGGACGCAAAGATAAAGCCCAAAGAGCCT
GGGGCTTTCTTCTGTTTAACCCACAGTTCCAACGGAATGTGAAGAGCCCC
TCCAATATAATGCCCACGGAAAGCTCATCCAGCGAGATCTCCGGCGGAGG
AGGCGGTGCGATACCCATGCTGCGACCTTCCCGGATGGATCAGTTCATGA
ACTCGATGGCGGCGGCAGCGGCGGCGGTGGGTGGTGGCGGTCTTCCTGGT
GCGGCGGATAGGAACGGCGGATCCGGAGGATCGGATGGTGGCTCCCAGAA
TGGCAACGGCGATTCGCGCAACTCATCGGCCAGCCGGATCTCAGCGTATG
AAACACAGCTGGCCTATCAGCAGCATTTGGCCGGACTGCATGGTCCGCCG
CCACCGCCACCACCATCGCATCATCGCGAGATCTCTGCCTTTGTGCCGGT
TCTGCCCACCGGAAAGGTGCGCCCGGGTAGTAATTCCAATTACGAAATCA
TTGCCATGATGGCGGACAAGCGAAAGGAGTTGGCCCTAAGGGAGGCGGCT
GCGGCGGCGGCAATGTTAGGACGAGGTCCTGGAGGACCCGGCGGTCCTGG
TGTGCCACCGCCTGGAGTGTTGTACGGACCAGCTGGCGTGCCACCTCCGC
CATATCTCACCGGACCGGGTCCATCGCCCACGGGAGCCGGAAGTTTTCCA
TTTCCACCAGGAGCCGCCGCCGCAGCTCTATTTCCACCTGGCCTGGGTCC
TGGAATGCATGCCGGACTCGATAGGCGCCTGCTACGTGCTCCTGGTCGGG
CATCGCGGCCTAAAAAACAGTTCATCTGCAAGTTCTGCAATCGACAATTC
ACCAAGTCGTACAATCTGCTCATCCACGAGAGGACACACACGGACGAGCG
GCCCTATTCCTGTGATATCTGCGGCAAGGCGTTCCGGCGACAGGATCACC
TGAGGGATCACAGGTATATTCACTCCAAGGAGAAACCCTTCAAATGCACG
GAATGCGGCAAGGGATTCTGCCAATCGAGAACCTTGGCTGTCCACAAGAT
CCTGCACATGGAGGAATCACCCCACAAGTGCCCCGTCTGCAGTCGATCAT
TCAATCAGCGCTCCAACCTGAAGACCCATCTGCTCACCCACACGGATCAC
AAGCCCTACGAGTGCTCTTCATGCGGCAAAGTTTTCCGCCGTAACTGCGA
TCTACGACGCCATGCCTTGACCCATGCAGTGGGTGAGGTCAACTCCGGGG
ACTATGTGGATGTGGGCGAAGAGGATGAGGCCAGAAATTTAAGTGGCGAC
GAGGAGGATTCGTTGCTGGAAGTGGACTCGCCTCGCCAGTCGCCAGTTCA
CAATTTGGGCGAGTCTGGAGGATCGGGTGAGAAATCTGAGTCCGAAAGAA
TGAGACTCAAGCGCAAGGCAGCCATCGATCATGAGGAAAGCGAAGAGGAG
TTCGATGACTTCGACGAGGAAGAGGAACTGCAGGATCTGCCAAGAGTACA
CGATTTGCCCAGGGAAGAGGACGACGACTTTGATCCCGAGGACGAGGAGC
AGGCAGAAGTGGCACTAGTGGCGCGTTTCCAGGCGAGTAAGGCTGCCGCC
ACATCGCAATCATCGTCGTCAGTGGGCACCAAGCCGGAACGCCAGGGAGT
CACCCACTGTCATCATGAGGGTGGTGAAACCTACACAATGCGGCCACATG
GCGAGAAACATCAGGAGGAACCCGGGAACTCTGGCATTGCCAGCCTACCC
GTTCCACCTTCCTTTGTGCGATATTCTGTACCACCTGGGGCAGCTGGACC
GCCGCCTGCACCACCTGGAGCTCCTCCGCCAACCCACCAGCACCCAGGAC
ATCCACACTTACTCCCACCCAACGGGGATCCCTATTTGCCCATTCTGCAC
GTTCGACGCGACTTGCACCACAAGAGCTTGAACCTTTCGAAGGCTGGTGT
TCCACCGCCACCACATACACCACCCACTATAATAACCCAGCCGGAGTCGG
GTAAACCACCCAATCAACCTTTGCATTCACCGCATGAAGCTATGCCCAGC
TTCCTGGGATCGATACCCATGCGAAAGAGGATTCTTCCGGCACCGACCTT
GGACTTGATGGATCCGCACCACCATCCTGGATTGGGTCAAAGGACCTTTG
TGGATAGTCCCAGCATATATGCTTTGAATATGTCGCGACATCCCCCCAGA
CAGCTTCTGGGAAAACCACCGAGTACGGAAACAAGTGGAGCCACCACCGA
AAAGGGACCACCAGTGGCAGCACCGCCCATAGCACCACCGCCTGCACCAC
CGAGAAGAACAGGGTTCAGCATTGAGGACATAATGAGGCGTTAGAAGTAA
ACCGAGAAAGAACTAGAAAACAATCCATTAATGGAGGTAAAATCGGAATA
GAAAAACAACACAATTTGGAAAACTATTTATCAAAGCTCTTACGAATTTG
AAATATCAAAAAGTAGTAGTATTCCTAATAAATATATATCTCGGTTGTTT
TTTCTGGTATTTCATTTAGAAGGTCTTATGAACAGTTGAATATCATAATG
ACAAACAGTTATTGTTCCCAATGGTTAAACGAGGATTTATCGTTTTAGAC
CCACAAGTACATTAAAATAAATTTAGATCTACAATTTAATACTTTTTAGT
ACAATGTCTAGGCAAGGCAATAGACCTAAACTAAGTAATAAAATCAGTTA
AGCGATAATTGTAAGCGAAACAAACTCCGTTGTTGCATTTTATAGAGCTC
TTATGCGTTAGGATTTTAGCTTAAATCTACCGATTTAAATGTTTAAGCCT
TTAGTACGAGAGTCTATCGATTAGTTTTTAATGTGTGGCCCAACACTAAG
TGTTGCTGTTTGCTGAGTGAATTCCAATTTTTTATTTATGTTTCCTTATC
CGGTAAGCTAATCTTAATGAGTAAACAAAATCGTTAATCGATTTTGCTGT
AGGGAAAAAAATGGTTGAAAGTAAAAGTTAGTGTAAAGCAGAGCATAAAC
AAAAATCCAACTACAAGCAACATTCCAGTAGAACCTTATGTAATTAGGCT
TAAATTTTAAGAGTTTTGCAGTAGTTAATATAAGCAACCCATAGAATTCC
ATGGTCTTCCTTCAATTTTAAATGATTTTATTCAAACCATAGCGAGTTAG
TTGATTTCAAATAAAGTATGCATTAATAATGAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

LD15350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-RD 3733 bowl-RD 95..3730 1..3636 18180 100 Plus
bowl-RB 3517 bowl-RB 167..3512 291..3636 16730 100 Plus
bowl.a 3508 bowl.a 160..3505 291..3636 16730 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3781427..3783647 1411..3631 11090 100 Plus
chr2L 23010047 chr2L 3779213..3780104 524..1415 4445 99.9 Plus
chr2L 23010047 chr2L 3771543..3771831 1..289 1445 100 Plus
chr2L 23010047 chr2L 3771979..3772212 293..526 1155 99.6 Plus
chr2L 23010047 chr2L 3604733..3605051 1574..1256 695 81.2 Minus
chr2L 23010047 chr2L 3578024..3578263 1650..1411 630 84.2 Minus
chr2L 23010047 chr2L 3578404..3578565 1416..1255 480 86.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-RH 2235 CG10021-PH 1..2235 560..2794 11175 100 Plus
bowl-RG 2235 CG10021-PG 1..2235 560..2794 11175 100 Plus
bowl-RF 2235 CG10021-PF 1..2235 560..2794 11175 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:02:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-RD 3630 CG10021-RD 1..3630 2..3631 18150 100 Plus
bowl-RF 3507 CG10021-RF 167..3507 291..3631 16705 100 Plus
bowl-RB 3513 CG10021-RB 173..3513 291..3631 16705 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-PH 744 CG10021-PH 216..744 1205..2791 2158 100 Plus
bowl-PG 744 CG10021-PG 216..744 1205..2791 2158 100 Plus
bowl-PF 744 CG10021-PF 216..744 1205..2791 2158 100 Plus
bowl-PA 744 CG10021-PA 216..744 1205..2791 2158 100 Plus
bowl-PD 744 CG10021-PD 216..744 1205..2791 2158 100 Plus
bowl-PH 744 CG10021-PH 1..145 560..994 374 100 Plus
bowl-PG 744 CG10021-PG 1..145 560..994 374 100 Plus
bowl-PF 744 CG10021-PF 1..145 560..994 374 100 Plus
bowl-PA 744 CG10021-PA 1..145 560..994 374 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3781901..3784126 1411..3636 11130 100 Plus
2L 23513712 2L 3779690..3780581 524..1415 4460 100 Plus
2L 23513712 2L 3772025..3772316 1..292 1460 100 Plus
2L 23513712 2L 3772461..3772694 293..526 1170 100 Plus
2L 23513712 2L 3605212..3605530 1574..1256 695 81.2 Minus
2L 23513712 2L 3578472..3578711 1650..1411 630 84.2 Minus
2L 23513712 2L 3578852..3579013 1416..1255 465 85.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3781901..3784126 1411..3636 11130 100 Plus
2L 23513712 2L 3779690..3780581 524..1415 4460 100 Plus
2L 23513712 2L 3772025..3772316 1..292 1460 100 Plus
2L 23513712 2L 3772461..3772694 293..526 1170 100 Plus
2L 23513712 2L 3605212..3605530 1574..1256 695 81.1 Minus
2L 23513712 2L 3578472..3578711 1650..1411 630 84.1 Minus
2L 23513712 2L 3578852..3579013 1416..1255 465 85.8 Minus
Blast to na_te.dros performed on 2014-11-27 07:46:55 has no hits.

LD15350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:13:24 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3781430..3783647 1414..3631 99   Plus
chr2L 3779216..3780102 527..1413 95 -> Plus
chr2L 3771979..3772212 293..526 99 -> Plus
chr2L 3771543..3771834 1..292 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:29 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..2235 560..2794 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:03 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..2235 560..2794 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:59 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RF 1..2235 560..2794 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:22 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..2235 560..2794 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:24 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RF 1..2235 560..2794 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:28 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..3630 2..3631 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:03 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..3630 2..3631 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:59 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..3630 2..3631 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:23 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..3630 2..3631 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:24 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 1..3630 2..3631 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:13:24 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3781904..3784121 1414..3631 100   Plus
2L 3779693..3780579 527..1413 100 -> Plus
2L 3772461..3772694 293..526 100 -> Plus
2L 3772025..3772316 1..292 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:59 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3781904..3784121 1414..3631 100   Plus
arm_2L 3779693..3780579 527..1413 100 -> Plus
arm_2L 3772461..3772694 293..526 100 -> Plus
arm_2L 3772025..3772316 1..292 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:13 Download gff for LD15350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3781904..3784121 1414..3631 100   Plus
2L 3779693..3780579 527..1413 100 -> Plus
2L 3772461..3772694 293..526 100 -> Plus
2L 3772025..3772316 1..292 100 -> Plus

LD15350.pep Sequence

Translation from 559 to 2793

> LD15350.pep
MPTESSSSEISGGGGGAIPMLRPSRMDQFMNSMAAAAAAVGGGGLPGAAD
RNGGSGGSDGGSQNGNGDSRNSSASRISAYETQLAYQQHLAGLHGPPPPP
PPSHHREISAFVPVLPTGKVRPGSNSNYEIIAMMADKRKELALREAAAAA
AMLGRGPGGPGGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPP
GAAAAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKS
YNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECG
KGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPY
ECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDEED
SLLEVDSPRQSPVHNLGESGGSGEKSESERMRLKRKAAIDHEESEEEFDD
FDEEEELQDLPRVHDLPREEDDDFDPEDEEQAEVALVARFQASKAAATSQ
SSSSVGTKPERQGVTHCHHEGGETYTMRPHGEKHQEEPGNSGIASLPVPP
SFVRYSVPPGAAGPPPAPPGAPPPTHQHPGHPHLLPPNGDPYLPILHVRR
DLHHKSLNLSKAGVPPPPHTPPTIITQPESGKPPNQPLHSPHEAMPSFLG
SIPMRKRILPAPTLDLMDPHHHPGLGQRTFVDSPSIYALNMSRHPPRQLL
GKPPSTETSGATTEKGPPVAAPPIAPPPAPPRRTGFSIEDIMRR*

LD15350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15254-PA 762 GF15254-PA 24..762 19..744 2491 83.5 Plus
Dana\GF14663-PA 598 GF14663-PA 410..552 233..375 794 93.7 Plus
Dana\GF14661-PA 390 GF14661-PA 210..331 233..354 599 82 Plus
Dana\GF19706-PA 454 GF19706-PA 176..306 238..368 337 45 Plus
Dana\GF15430-PA 783 GF15430-PA 563..704 230..371 330 42.3 Plus
Dana\GF19706-PA 454 GF19706-PA 136..282 227..372 317 42.9 Plus
Dana\GF19706-PA 454 GF19706-PA 146..255 264..373 272 43.6 Plus
Dana\GF19706-PA 454 GF19706-PA 206..307 240..341 222 35.3 Plus
Dana\GF19706-PA 454 GF19706-PA 144..227 290..373 177 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24967-PA 744 GG24967-PA 1..744 1..744 3832 98.7 Plus
Dere\GG24427-PA 585 GG24427-PA 397..539 233..375 781 93 Plus
Dere\GG24424-PA 394 GG24424-PA 215..335 231..351 602 82.6 Plus
Dere\GG24566-PA 617 GG24566-PA 352..496 238..385 340 43 Plus
Dere\GG10437-PA 759 GG10437-PA 536..677 230..371 330 42.3 Plus
Dere\GG24566-PA 617 GG24566-PA 312..458 227..372 319 42.9 Plus
Dere\GG24566-PA 617 GG24566-PA 322..431 264..373 273 43.6 Plus
Dere\GG24566-PA 617 GG24566-PA 320..403 290..373 178 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13710-PA 763 GH13710-PA 1..763 1..744 1895 65.1 Plus
Dgri\GH13192-PA 656 GH13192-PA 461..603 233..375 795 93.7 Plus
Dgri\GH13191-PA 416 GH13191-PA 207..358 197..346 605 71.4 Plus
Dgri\GH25019-PA 701 GH25019-PA 407..550 238..384 339 43.2 Plus
Dgri\GH10862-PA 748 GH10862-PA 418..561 238..384 338 43.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-PH 744 CG10021-PH 1..744 1..744 4042 100 Plus
bowl-PG 744 CG10021-PG 1..744 1..744 4042 100 Plus
bowl-PF 744 CG10021-PF 1..744 1..744 4042 100 Plus
bowl-PA 744 CG10021-PA 1..744 1..744 4042 100 Plus
bowl-PD 744 CG10021-PD 1..744 1..744 4042 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23940-PA 752 GI23940-PA 1..752 1..744 1959 66.3 Plus
Dmoj\GI17769-PA 648 GI17769-PA 390..595 187..374 792 71.6 Plus
Dmoj\GI17766-PA 464 GI17766-PA 278..391 233..346 598 86.8 Plus
Dmoj\GI13715-PA 641 GI13715-PA 359..502 238..384 337 43.2 Plus
Dmoj\GI23984-PA 747 GI23984-PA 539..680 230..371 329 42.3 Plus
Dmoj\GI13715-PA 641 GI13715-PA 319..465 227..372 313 42.2 Plus
Dmoj\GI13715-PA 641 GI13715-PA 329..438 264..373 272 43.6 Plus
Dmoj\GI13715-PA 641 GI13715-PA 327..410 290..373 179 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18676-PA 757 GL18676-PA 1..757 1..744 2072 71.7 Plus
Dper\GL19470-PA 654 GL19470-PA 453..595 233..375 785 93 Plus
Dper\GL19469-PA 397 GL19469-PA 243..351 246..354 522 80.7 Plus
Dper\GL18461-PA 642 GL18461-PA 370..513 238..384 343 43.2 Plus
Dper\GL20484-PA 235 GL20484-PA 53..205 225..376 314 42.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10014-PA 754 GA10014-PA 1..754 1..742 2089 71.9 Plus
Dpse\GA25976-PA 600 GA25976-PA 399..540 233..374 791 93.7 Plus
Dpse\GA17731-PA 426 GA17731-PA 235..353 233..351 592 83.2 Plus
Dpse\GA23315-PA 207 GA23315-PA 31..207 587..744 483 67.4 Plus
Dpse\GA16381-PA 649 GA16381-PA 313..520 179..384 349 38.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18435-PA 504 GM18435-PA 1..487 1..487 2545 99.2 Plus
Dsec\GM18436-PA 226 GM18436-PA 5..226 523..744 825 96.8 Plus
Dsec\GM18136-PA 580 GM18136-PA 392..534 233..375 789 93 Plus
Dsec\GM18135-PA 389 GM18135-PA 210..325 231..346 601 85.3 Plus
Dsec\GM16579-PA 611 GM16579-PA 346..490 238..385 340 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23254-PA 1439 GD23254-PA 1..741 1..741 3841 99.3 Plus
Dsim\GD22744-PA 576 GD22744-PA 388..530 233..375 780 92.3 Plus
Dsim\GD22743-PA 391 GD22743-PA 212..327 231..346 601 85.3 Plus
Dsim\GD22883-PA 620 GD22883-PA 346..490 238..385 340 43 Plus
Dsim\GD22883-PA 620 GD22883-PA 306..452 227..372 318 42.9 Plus
Dsim\GD11921-PA 498 GD11921-PA 216..351 236..375 315 40.7 Plus
Dsim\GD22883-PA 620 GD22883-PA 316..425 264..373 272 43.6 Plus
Dsim\GD22883-PA 620 GD22883-PA 314..397 290..373 177 41.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21213-PA 775 GJ21213-PA 1..775 1..744 1959 65 Plus
Dvir\GJ17594-PA 654 GJ17594-PA 458..602 231..375 802 92.4 Plus
Dvir\GJ17592-PA 423 GJ17592-PA 238..351 233..346 601 86.8 Plus
Dvir\GJ19651-PA 708 GJ19651-PA 363..493 238..368 338 45 Plus
Dvir\GJ21268-PA 735 GJ21268-PA 528..669 230..371 326 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14650-PA 794 GK14650-PA 1..794 1..744 1917 63.9 Plus
Dwil\GK15478-PA 565 GK15478-PA 364..506 233..375 790 93 Plus
Dwil\GK15475-PA 416 GK15475-PA 225..338 233..346 596 86 Plus
Dwil\GK24242-PA 742 GK24242-PA 509..650 230..371 331 42.3 Plus
Dwil\GK14726-PA 913 GK14726-PA 281..467 174..372 324 36.3 Plus
Dwil\GK24242-PA 742 GK24242-PA 488..596 266..373 217 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18258-PA 745 GE18258-PA 1..745 1..744 2893 98.1 Plus
Dyak\GE14841-PA 585 GE14841-PA 397..539 233..375 788 93 Plus
Dyak\GE14830-PA 395 GE14830-PA 215..335 231..351 598 82.6 Plus
Dyak\GE15291-PA 626 GE15291-PA 359..503 238..385 341 43 Plus
Dyak\GE14143-PA 742 GE14143-PA 533..669 235..371 332 43.1 Plus
Dyak\GE15291-PA 626 GE15291-PA 319..465 227..372 320 42.9 Plus
Dyak\GE15291-PA 626 GE15291-PA 329..438 264..373 274 43.6 Plus
Dyak\GE15291-PA 626 GE15291-PA 327..410 290..373 179 41.7 Plus

LD15350.hyp Sequence

Translation from 559 to 2793

> LD15350.hyp
MPTESSSSEISGGGGGAIPMLRPSRMDQFMNSMAAAAAAVGGGGLPGAAD
RNGGSGGSDGGSQNGNGDSRNSSASRISAYETQLAYQQHLAGLHGPPPPP
PPSHHREISAFVPVLPTGKVRPGSNSNYEIIAMMADKRKELALREAAAAA
AMLGRGPGGPGGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPP
GAAAAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKS
YNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECG
KGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPY
ECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDEED
SLLEVDSPRQSPVHNLGESGGSGEKSESERMRLKRKAAIDHEESEEEFDD
FDEEEELQDLPRVHDLPREEDDDFDPEDEEQAEVALVARFQASKAAATSQ
SSSSVGTKPERQGVTHCHHEGGETYTMRPHGEKHQEEPGNSGIASLPVPP
SFVRYSVPPGAAGPPPAPPGAPPPTHQHPGHPHLLPPNGDPYLPILHVRR
DLHHKSLNLSKAGVPPPPHTPPTIITQPESGKPPNQPLHSPHEAMPSFLG
SIPMRKRILPAPTLDLMDPHHHPGLGQRTFVDSPSIYALNMSRHPPRQLL
GKPPSTETSGATTEKGPPVAAPPIAPPPAPPRRTGFSIEDIMRR*

LD15350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-PH 744 CG10021-PH 1..744 1..744 4042 100 Plus
bowl-PG 744 CG10021-PG 1..744 1..744 4042 100 Plus
bowl-PF 744 CG10021-PF 1..744 1..744 4042 100 Plus
bowl-PA 744 CG10021-PA 1..744 1..744 4042 100 Plus
bowl-PD 744 CG10021-PD 1..744 1..744 4042 100 Plus