Clone LD15481 Report

Search the DGRC for LD15481

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:154
Well:81
Vector:pBS SK-
Associated Gene/TranscriptRs1-RA
Protein status:LD15481.pep: gold
Preliminary Size:2974
Sequenced Size:2505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2173 2001-01-01 Release 2 assignment
CG2173 2003-01-01 Sim4 clustering to Release 3
CG2173 2003-02-28 Blastp of sequenced clone
Rs1 2008-04-29 Release 5.5 accounting
Rs1 2008-08-15 Release 5.9 accounting
Rs1 2008-12-18 5.12 accounting

Clone Sequence Records

LD15481.complete Sequence

2505 bp (2505 high quality bases) assembled on 2003-02-28

GenBank Submission: BT004908

> LD15481.complete
CGCTGGTGGAGTTTTGAATAGTTCTTTGCTTCAAAAATGGGTGCAACCAA
GAACCTGGACTTGATAGGCACCATCGAAGACGATGCCGAGGTGGAGAACT
TGTCGGAGGACTCCGATGCGGAGGTCGAGTACCAACCCACAAAACTGAGA
CACAAGAAGGTGACGGAGTTTGAGAAGGGCTTCGAGTTCGTGTCCTCAGT
GAAGGAGTACAACCAGGACACTTGGGACGACCTGATGAAGTACGTGAAGC
GAAAGGCGCGCACAAAGACCGACGACAAGATCGCCGCCCGGCTGCAAAAG
CGGGGTGGCGCCGAAGCTGTGGCCGCGGAGCAGAGCGATGGAAGTGAGAT
AGATCTCTCCGAGGACGAATTGAAGCATGACAACCTGCGGCTAAGGGAGA
AGAAGGAATCCAAAAAAAAGAAGAAGAAGGCTGGAGAGGAGGATGAAGAG
GACGAGGGCGAGAAGATGCAGTTCGCCGACACTGTAGAGGCGAACGAGCA
GATCACTTCCTTCTACCAAATGAACCTTTCACGTCCCCTGATGCGTGCCA
TCGGTGTGCTGGGGTACATATATCCTACGCCGATCCAGGCCTCTACGATT
CCTGTGGCTTTGCTAGGTCGCGATATCTGCGGCTGTGCTGCCACGGGAAC
GGGCAAAACTGCTGCTTATATGTTGCCTACTCTAGAACGTTTGCTGTATC
GTCCTCTTAACAACAAGGCCATCACCAGGGTACTGGTTCTTGTGCCCACT
CGTGAGCTGGGCGCCCAGGTTTACCAGGTGACAAAGCAATTGTGCCAGTT
CACCACTATTGATGTGGGTCTGGCAATTGGTGGTCTGGATGTGAAGGCTC
AGGAGGCAGTACTTCGCCAGAATCCCGACATTGTCATTGCAACGCCAGGT
CGTCTAATCGATCACATTAAAAATACGCCCAGTTTTACATTGGATTCCAT
TGAGGTTCTCATTCTGGACGAGGCCGATCGTATGCTGGACGAGTACTTCG
CCGAACAGATGAAGGAGATCATCAACTCCTGCTGTAAGACACGTCAGACC
ATGTTGTTCTCCGCCACAATGAGCGAGCAGGTCAAAGATCTGGCCGCCGT
ATCGCTGGACAAGCCCATCAAGGTGTTCGTCAACAACAACCAGCAAGTGG
CCTTCAATCTGCGTCAGGAATTTATTCGCATACGTGAGGATAAGGAGGGC
GACCGTGAACCCATTCTGGCTAGTTTGATTTGCAGGACGTTCCATGATCA
TTGCATGGTATTTGTGCAAACCAAAAAGCAGGCCCATCGACTGCACATTT
TATTGGGTCTCTTGGGCGTCCGGGCCGGCGAACTGCATGGCAATCTCACC
CAGCAACAGCGTCTGGAGTCCCTCAAGAAGTTCAAGGAGGAGCAGATTGA
TGTGCTTATCGCCACAGATGTAGCTGCTCGTGGTCTCGATATTGTGGGCG
TAAAAACGGTAATCAACTTTGTGATGCCCATCACCACAGAGCACTACATC
CATCGAGTGGGTCGTACGGCTCGAGCTGGGCGTGCTGGTATATCCGTTTC
CCTGGCCGGTGAAAAGGAGCGCAAGATCGTTAAGGACATTATCAAGAATG
CGGAGAGTACCATTAAGAATCGTATTATTCCGCCAGAGATTATTGAAAAA
TATCGCAACAAACTTACAAGCTTGGAGCCAGAGATTCAAAACATTCTGGA
CGAAGAGCAGGCTGAACGGCAGCTAGCCAAAACGGAGCAACAGCTCTCCA
AAACGGAGCGAAAGCTGCTGGGACAGACCAACGAGCGACGTGGTTGGTTC
CAGACGAAACAGCAACGCGAGGCGGAGAAGGATCGCTTAGCGTTGACAAC
CGGCGACGAGGATAAAGCATCTGGTGGAAAGGGTAAGGGAAAAACGGCCG
GAAAGCGTAAGCGACCCGAGTACGGAGGCGATGGCGAGGATGGACCACCG
GTCAAGGATCTCGAGGCAAAGCGCAACAAGAAGAAGAAGGAGGAGCCTCG
AAAGAAGACACCGGAGCAGCTGGCCAAAGAGCGAGCCATGAAGGAGATCG
AGAAGGTGTCCCTTGTGCGCGCCAAGATGGCCAAGCTGCGCAAACGTCCG
GGCAAACTAGGAGCCGCCACCGAAGTTCACAGAAGCGGTGCCTCCGACGG
CAAACCCAAGCGACGCGGCGGTCAGTCGGCATTTACTAACGACTTGACCG
ATGTAAGTCGTGGCGGAGCTCTGCGTCTAAGGTCCGAGGCCAATCGGCAC
AAAAAGATGACCAAGATCGCTGCTAAGAAAAAGGCGAGCAGTGTGAAGCT
GACAAACAAGGCGGGAAAGAATAAGTTCAACAAGGGCAAGAACTTCGGAG
GACCTCGTCACGCCAAGAAGGATAAAAAGAAGTAGAGCTGCAAACTACGC
TATGTTAAATCGTATACTTGTAAAATAAAACTTTTTCTTCTTTAAGGCAT
TTAATTTTTTTAATTTGCTTTAAACATATGACACCTCAAAAAAAAAAAAA
AAAAA

LD15481.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-RA 2672 Rs1-RA 132..2627 1..2496 12465 99.9 Plus
Rs1.b 2609 Rs1.b 94..2575 15..2496 12380 99.9 Plus
Rs1.a 2645 Rs1.a 137..2611 22..2496 12360 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 01:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4052624..4053452 128..956 4130 99.9 Plus
chr2R 21145070 chr2R 4053648..4054382 953..1687 3675 100 Plus
chr2R 21145070 chr2R 4054443..4054988 1688..2233 2730 100 Plus
chr2R 21145070 chr2R 4055046..4055303 2230..2487 1290 100 Plus
chr2R 21145070 chr2R 4052439..4052567 1..129 645 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-RB 2349 CG2173-PB 1..2349 37..2385 11745 100 Plus
Rs1-RA 2349 CG2173-PA 1..2349 37..2385 11745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:03:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-RA 2527 CG2173-RA 41..2527 1..2487 12435 100 Plus
Rs1-RB 2670 CG2173-RB 205..2670 22..2487 12330 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-PB 782 CG2173-PB 1..776 37..2364 3049 100 Plus
Rs1-PA 782 CG2173-PA 1..776 37..2364 3049 100 Plus
CG9253-PA 507 CG9253-PA 56..388 490..1509 501 39.4 Plus
Dbp45A-PA 521 CG12759-PA 4..419 496..1734 437 34.2 Plus
Rm62-PH 575 CG10279-PH 136..512 502..1614 430 35.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8165105..8165933 128..956 4145 100 Plus
2R 25286936 2R 8166114..8166848 953..1687 3675 100 Plus
2R 25286936 2R 8166909..8167454 1688..2233 2730 100 Plus
2R 25286936 2R 8167512..8167778 2230..2496 1320 99.6 Plus
2R 25286936 2R 8164920..8165048 1..129 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8166304..8167132 128..956 4145 100 Plus
2R 25260384 2R 8167313..8168047 953..1687 3675 100 Plus
2R 25260384 2R 8168108..8168653 1688..2233 2730 100 Plus
2R 25260384 2R 8168711..8168977 2230..2496 1320 99.6 Plus
2R 25260384 2R 8166119..8166247 1..129 645 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:28:56 has no hits.

LD15481.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:01:05 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4055048..4055303 2232..2487 100   Plus
chr2R 4054443..4054986 1688..2231 100 -> Plus
chr2R 4053650..4054382 955..1687 100 -> Plus
chr2R 4052962..4053450 466..954 100 -> Plus
chr2R 4052626..4052891 130..395 99 == Plus
chr2R 4052439..4052567 1..129 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:50:09 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 1..2349 37..2385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:35 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 1..2349 37..2385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:29 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 1..2349 37..2385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:02 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 1..2349 37..2385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:05 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 1..2349 37..2385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:58:05 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 36..2522 1..2487 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:35 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 36..2522 1..2487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:29 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 41..2527 1..2487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:02 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 36..2522 1..2487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:05 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 41..2527 1..2487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:01:05 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8167514..8167769 2232..2487 100   Plus
2R 8166909..8167452 1688..2231 100 -> Plus
2R 8166116..8166848 955..1687 100 -> Plus
2R 8165107..8165931 130..954 100 -> Plus
2R 8164920..8165048 1..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:29 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4055019..4055274 2232..2487 100   Plus
arm_2R 4054414..4054957 1688..2231 100 -> Plus
arm_2R 4053621..4054353 955..1687 100 -> Plus
arm_2R 4052612..4053436 130..954 100 -> Plus
arm_2R 4052425..4052553 1..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:14 Download gff for LD15481.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8168713..8168968 2232..2487 100   Plus
2R 8168108..8168651 1688..2231 100 -> Plus
2R 8167315..8168047 955..1687 100 -> Plus
2R 8166306..8167130 130..954 100 -> Plus
2R 8166119..8166247 1..129 100 -> Plus

LD15481.pep Sequence

Translation from 36 to 2384

> LD15481.pep
MGATKNLDLIGTIEDDAEVENLSEDSDAEVEYQPTKLRHKKVTEFEKGFE
FVSSVKEYNQDTWDDLMKYVKRKARTKTDDKIAARLQKRGGAEAVAAEQS
DGSEIDLSEDELKHDNLRLREKKESKKKKKKAGEEDEEDEGEKMQFADTV
EANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGC
AATGTGKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTK
QLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSF
TLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVK
DLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDKEGDREPILASLICR
TFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFK
EEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRA
GISVSLAGEKERKIVKDIIKNAESTIKNRIIPPEIIEKYRNKLTSLEPEI
QNILDEEQAERQLAKTEQQLSKTERKLLGQTNERRGWFQTKQQREAEKDR
LALTTGDEDKASGGKGKGKTAGKRKRPEYGGDGEDGPPVKDLEAKRNKKK
KEEPRKKTPEQLAKERAMKEIEKVSLVRAKMAKLRKRPGKLGAATEVHRS
GASDGKPKRRGGQSAFTNDLTDVSRGGALRLRSEANRHKKMTKIAAKKKA
SSVKLTNKAGKNKFNKGKNFGGPRHAKKDKKK*

LD15481.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13667-PA 782 GF13667-PA 1..782 1..782 3752 94.9 Plus
Dana\GF14739-PA 525 GF14739-PA 60..425 133..518 663 39.5 Plus
Dana\GF16329-PA 784 GF16329-PA 228..666 116..520 585 34.4 Plus
Dana\GF12227-PA 522 GF12227-PA 5..354 155..506 582 38.7 Plus
Dana\GF25051-PA 826 GF25051-PA 40..383 159..506 573 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23340-PA 782 GG23340-PA 1..782 1..782 4112 99.1 Plus
Dere\GG21281-PA 524 GG21281-PA 50..423 138..518 663 39.8 Plus
Dere\GG23409-PA 526 GG23409-PA 6..354 157..506 568 38.5 Plus
Dere\GG17436-PA 793 GG17436-PA 289..671 156..520 568 35.1 Plus
Dere\GG14669-PA 827 GG14669-PA 41..386 159..508 568 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21077-PA 790 GH21077-PA 1..790 1..782 3618 91.1 Plus
Dgri\GH13670-PA 518 GH13670-PA 54..411 154..518 664 40.4 Plus
Dgri\GH21617-PA 524 GH21617-PA 5..354 155..506 580 38.4 Plus
Dgri\GH22875-PA 799 GH22875-PA 291..674 155..520 563 34.3 Plus
Dgri\GH17046-PA 811 GH17046-PA 291..669 156..537 558 34.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-PB 782 CG2173-PB 1..782 1..782 3959 100 Plus
Rs1-PA 782 CG2173-PA 1..782 1..782 3959 100 Plus
CG9253-PA 507 CG9253-PA 6..415 99..518 665 36.7 Plus
Dbp45A-PA 521 CG12759-PA 4..521 154..667 557 30.9 Plus
pit-PC 680 CG6375-PC 60..588 24..565 549 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18677-PA 787 GI18677-PA 1..787 1..782 3594 92.4 Plus
Dmoj\GI21075-PA 515 GI21075-PA 45..413 134..518 666 39.9 Plus
Dmoj\GI20069-PA 521 GI20069-PA 9..354 159..506 577 38.8 Plus
Dmoj\GI24146-PA 829 GI24146-PA 40..383 159..506 572 35.1 Plus
Dmoj\GI13281-PA 649 GI13281-PA 234..602 156..525 566 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11206-PA 785 GL11206-PA 1..785 1..782 3568 93 Plus
Dper\GL25891-PA 518 GL25891-PA 46..423 135..518 660 39.4 Plus
Dper\GL17616-PA 527 GL17616-PA 9..354 159..506 576 38.8 Plus
Dper\GL16100-PA 854 GL16100-PA 41..384 159..506 576 35.4 Plus
Dper\GL24500-PA 799 GL24500-PA 233..671 116..520 570 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15282-PA 785 GA15282-PA 1..785 1..782 3574 93.1 Plus
Dpse\GA21647-PA 518 GA21647-PA 46..423 135..518 660 39.4 Plus
Dpse\GA27302-PA 800 GA27302-PA 234..672 116..520 580 34.2 Plus
Dpse\GA11795-PA 527 GA11795-PA 9..354 159..506 577 38.8 Plus
Dpse\GA16838-PA 852 GA16838-PA 41..384 159..506 577 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21012-PA 782 GM21012-PA 1..782 1..782 4109 99.1 Plus
Dsec\GM23393-PA 519 GM23393-PA 29..419 106..518 673 38.4 Plus
Dsec\GM21090-PA 522 GM21090-PA 9..354 159..506 573 38.8 Plus
Dsec\GM26328-PA 797 GM26328-PA 237..675 116..520 571 33.9 Plus
Dsec\GM14284-PA 827 GM14284-PA 41..386 159..508 568 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10546-PA 782 GD10546-PA 1..782 1..782 4121 99.5 Plus
Dsim\GD24302-PA 519 GD24302-PA 29..419 106..518 674 38.6 Plus
Dsim\GD20854-PA 784 GD20854-PA 238..662 116..520 571 34.4 Plus
Dsim\GD10627-PA 527 GD10627-PA 9..354 159..506 570 38.8 Plus
Dsim\GD25714-PA 827 GD25714-PA 41..386 159..508 568 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21693-PA 784 GJ21693-PA 1..784 1..782 3690 92.9 Plus
Dvir\GJ16136-PA 523 GJ16136-PA 47..418 134..518 657 39.4 Plus
Dvir\GJ21163-PA 519 GJ21163-PA 9..354 159..506 570 38.5 Plus
Dvir\GJ23450-PA 829 GJ23450-PA 40..383 159..506 564 34.6 Plus
Dvir\vas-PA 625 GJ11891-PA 230..578 176..525 559 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15774-PA 792 GK15774-PA 1..792 1..782 3524 88.8 Plus
Dwil\GK21047-PA 507 GK21047-PA 44..409 147..518 659 40.1 Plus
Dwil\GK14071-PA 802 GK14071-PA 239..677 116..520 589 34.6 Plus
Dwil\GK23245-PA 506 GK23245-PA 8..354 158..506 581 38.8 Plus
Dwil\GK17652-PA 782 GK17652-PA 1..341 162..506 563 35.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19181-PA 782 GE19181-PA 1..782 1..782 4111 99.2 Plus
Dyak\GE12898-PA 522 GE12898-PA 63..422 152..518 661 40.2 Plus
Dyak\GE19250-PA 527 GE19250-PA 9..354 159..506 577 38.8 Plus
Dyak\bel-PA 792 GE24837-PA 233..671 116..520 571 33.9 Plus
Dyak\GE21030-PA 827 GE21030-PA 41..386 159..508 569 34.9 Plus

LD15481.hyp Sequence

Translation from 36 to 2384

> LD15481.hyp
MGATKNLDLIGTIEDDAEVENLSEDSDAEVEYQPTKLRHKKVTEFEKGFE
FVSSVKEYNQDTWDDLMKYVKRKARTKTDDKIAARLQKRGGAEAVAAEQS
DGSEIDLSEDELKHDNLRLREKKESKKKKKKAGEEDEEDEGEKMQFADTV
EANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGC
AATGTGKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTK
QLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSF
TLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVK
DLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDKEGDREPILASLICR
TFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFK
EEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRA
GISVSLAGEKERKIVKDIIKNAESTIKNRIIPPEIIEKYRNKLTSLEPEI
QNILDEEQAERQLAKTEQQLSKTERKLLGQTNERRGWFQTKQQREAEKDR
LALTTGDEDKASGGKGKGKTAGKRKRPEYGGDGEDGPPVKDLEAKRNKKK
KEEPRKKTPEQLAKERAMKEIEKVSLVRAKMAKLRKRPGKLGAATEVHRS
GASDGKPKRRGGQSAFTNDLTDVSRGGALRLRSEANRHKKMTKIAAKKKA
SSVKLTNKAGKNKFNKGKNFGGPRHAKKDKKK*

LD15481.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-PB 782 CG2173-PB 1..782 1..782 3959 100 Plus
Rs1-PA 782 CG2173-PA 1..782 1..782 3959 100 Plus
CG9253-PA 507 CG9253-PA 6..415 99..518 665 36.7 Plus
Dbp45A-PA 521 CG12759-PA 4..521 154..667 557 30.9 Plus
pit-PC 680 CG6375-PC 60..588 24..565 549 30.1 Plus