Clone LD15729 Report

Search the DGRC for LD15729

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:157
Well:29
Vector:pBS SK-
Associated Gene/TranscriptMED6-RA
Protein status:LD15729.pep: gold
Preliminary Size:1179
Sequenced Size:1814

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9473 2001-01-01 Release 2 assignment
CG9473 2002-05-17 Blastp of sequenced clone
MED6 2008-04-29 Release 5.5 accounting
MED6 2008-08-15 Release 5.9 accounting
MED6 2008-12-18 5.12 accounting

Clone Sequence Records

LD15729.complete Sequence

1814 bp (1814 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118517

> LD15729.complete
CTTAGCCGGTTATTTACACGGGACTTTGCAATATACACATCTCAGGTGGA
ATAAACAAAGTTGGCAGCCATGGAAACAGCACAGACACACGCACGATCGC
ATAGTTGAAAATCAAGACGCTCCCCTGCTGCTTCTTCTTCTCTGCACCAA
ACAAAGCGCTGCCACCTCGCGAAGAACGTACACTGTCCAACACGGGCCAG
CCGACTGGGTGCAGTGTTGCGAACTGCGGTCAGTCGACCAAGCGAAAATA
ACAAACAAATCGGTTTTTTAGCGAGCGCAAGGCAAATCACGAGTAGAAAA
CACAATAAAAGCTCGCTACAAAGGACAGTTAATCAGCAAAACACTTACAG
TATTAACGTGAAGGTGGAGCAGCGAGAGCAGCGTGCACCACGGCCTGCTA
AATTAATTATTACACAACAAATAAATCAAAAAACTGCCAGCGACAGTTTC
CAATCGACAGCGTGCGGCCGAAAATAGCTTGTAAACAAAGCGATCGCTAG
GAATAGGAAAAGGAAAAAGAAGCTCTCTCAACGCCATTGACCCACAAATT
AGTCGTGGTCATTGCCAAGCGAGAAAACATTGCAGCCGCTTCCCACCGCC
ACATCCCAACAAGGCGCACGTGCATCCACATCCACAATGGCCAGCCGACA
GATGACCAATGACCACCTGCGCCTTTCCTGGCACGACACCCAGATGATGG
CCACCCTCAGCCCGCAGACCGTCATGGACTACTTCTGCCGCAAGTCGAAT
CCCTTCTATGATCACATGTGCAACAACGAGACTGTTCGGATGCAGCGCCT
TGGTCCCGAGCATCTGCACAACATGATCGGTCTGGAATACATACTGCTGC
ACGTGGCGGAGCCCATCCTGTATGTAATCCGCAAGCAGCACCGTCATAAT
CCCTCGGAAGCCACGCCGATTGCCGATTACTACATCATTGGTGGCACCGT
CTACAAGGCGCCAGATCTTGCCAACGTCATCAATTCCCGCATTCTCAACA
CCGTGGTGAACCTGCAATCCGCCTTCGAGGAGGCTAGTAGCTATGCCCGC
TACCATCCCAACAAGGGCTACACGTGGGACTTCTCTTCCAATAAAGTTTT
TTCAGATAGATCCAAGTCAGATAAGAAGGACGCCAACTCAGCGAAGGATG
AGAACAGCGGCACACTGTTCCAGAAGCAGCGTGTGGACATGCTGCTGGCA
GAGCTTTTGCGTAAATTTCCCCCACCAATACCGCCCATGCTGCAGAATCT
CCAGCAGCCGCCACCAGCGGGCGATGATCTGAACACAGCGAGAAATGCCT
CCGAAATGAACAATGCCACAGGACCGCTAGATATCAAAACCGAGGGTGTG
GACATGAAGCCACCGCCCGAAAAGAAGAGCAAGTGATTATGTGAATGCAG
GTGCACCCTCAAAAAACGTACATACATATTAGTCCGAGTCCTTTGGCAGC
TGCATAAAAGGCGCTGAATGCTGCCTGCATTTCCACTGGCCAAACCAACG
CTCAGCGAAAAGCAGCGAAATCTACTTTTGCTAGTACTGCCAACTATTTT
TTTTTAAAGTGGCTCTAACTAGTGACCATTTAAATATTCAAATTTTAAAA
CGCAATTTTTGTTCCGTGAGAAAACAATTAAGAACAACAATCAATAACCT
TAACAAAAAAAAAAAGAAAACACAAAATTCAAAACTAAAATAGTTTTTAG
TAACCTAGAATATAATGTAATTACTGTCATTTAGACTACGATAGTTATTT
TTGTGTGAATGTCATACGAAAACCTAAAAAATTCACAAAGCAGTCCAAAA
AAAAAAAAAAAAAA

LD15729.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RA 1806 MED6-RA 11..1806 1..1796 8980 100 Plus
MED6-RC 1770 MED6-RC 90..1770 116..1796 8405 100 Plus
MED6.b 1741 MED6.b 91..1734 154..1797 8220 100 Plus
MED6.b 1741 MED6.b 1..93 24..116 465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5593012..5593708 818..122 3470 99.9 Minus
chr3R 27901430 chr3R 5591867..5592562 1796..1100 3390 99.4 Minus
chr3R 27901430 chr3R 5592783..5592957 993..819 875 100 Minus
chr3R 27901430 chr3R 5594200..5594315 116..1 580 100 Minus
chr3R 27901430 chr3R 5592623..5592728 1099..994 530 100 Minus
chrX 22417052 chrX 8585602..8585747 1555..1412 410 87 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RE 750 CG9473-PE 1..750 637..1386 3750 100 Plus
MED6-RD 750 CG9473-PD 1..750 637..1386 3750 100 Plus
MED6-RC 750 CG9473-PC 1..750 637..1386 3750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:03:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RA 1819 CG9473-RA 24..1819 1..1796 8980 100 Plus
MED6-RC 1770 CG9473-RC 90..1770 116..1796 8405 100 Plus
MED6-RB 1758 CG9473-RB 78..1758 116..1796 8405 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-PE 249 CG9473-PE 1..249 637..1383 1120 100 Plus
MED6-PD 249 CG9473-PD 1..249 637..1383 1120 100 Plus
MED6-PC 249 CG9473-PC 1..249 637..1383 1120 100 Plus
MED6-PA 249 CG9473-PA 1..249 637..1383 1120 100 Plus
MED6-PB 249 CG9473-PB 1..249 637..1383 1120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9767177..9767880 818..115 3520 100 Minus
3R 32079331 3R 9766030..9766727 1797..1100 3490 100 Minus
3R 32079331 3R 9766948..9767122 993..819 875 100 Minus
3R 32079331 3R 9768364..9768479 116..1 580 100 Minus
3R 32079331 3R 9766788..9766893 1099..994 530 100 Minus
X 23542271 X 8693832..8693977 1555..1412 410 87 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9508008..9508711 818..115 3520 100 Minus
3R 31820162 3R 9506861..9507558 1797..1100 3490 100 Minus
3R 31820162 3R 9507779..9507953 993..819 875 100 Minus
3R 31820162 3R 9509195..9509310 116..1 580 100 Minus
3R 31820162 3R 9507619..9507724 1099..994 530 100 Minus
X 23527363 X 8702001..8702075 1486..1412 285 92 Minus
X 23527363 X 8701930..8701988 1555..1497 220 91.5 Minus
Blast to na_te.dros performed on 2014-11-27 10:27:23 has no hits.

LD15729.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:43:32 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5594200..5594315 1..116 100   Minus
chr3R 5593012..5593714 117..818 99 <- Minus
chr3R 5592783..5592957 819..993 100 <- Minus
chr3R 5592623..5592728 994..1099 100 <- Minus
chr3R 5591867..5592562 1100..1796 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:50:26 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 1..750 637..1386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:01 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 1..750 637..1386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:06 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 1..750 637..1386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:33 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 1..750 637..1386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:32 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 1..750 637..1386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:25:49 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 1..1795 2..1796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:01 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:06 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 24..1819 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:33 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 1..1795 2..1796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:32 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 24..1819 1..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:43:32 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9768364..9768479 1..116 100   Minus
3R 9767177..9767878 117..818 100 <- Minus
3R 9766948..9767122 819..993 100 <- Minus
3R 9766788..9766893 994..1099 100 <- Minus
3R 9766031..9766727 1100..1796 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:06 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5594086..5594201 1..116 100   Minus
arm_3R 5592899..5593600 117..818 100 <- Minus
arm_3R 5592670..5592844 819..993 100 <- Minus
arm_3R 5592510..5592615 994..1099 100 <- Minus
arm_3R 5591753..5592449 1100..1796 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:53 Download gff for LD15729.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9509195..9509310 1..116 100   Minus
3R 9508008..9508709 117..818 100 <- Minus
3R 9507779..9507953 819..993 100 <- Minus
3R 9507619..9507724 994..1099 100 <- Minus
3R 9506862..9507558 1100..1796 100 <- Minus

LD15729.pep Sequence

Translation from 636 to 1385

> LD15729.pep
MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETV
RMQRLGPEHLHNMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYI
IGGTVYKAPDLANVINSRILNTVVNLQSAFEEASSYARYHPNKGYTWDFS
SNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFPPPIPP
MLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSK*

LD15729.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23191-PA 251 GF23191-PA 1..251 1..249 1175 90.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17328-PA 249 GG17328-PA 1..249 1..249 1267 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14337-PA 255 GH14337-PA 1..255 1..249 1141 82.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-PE 249 CG9473-PE 1..249 1..249 1325 100 Plus
MED6-PD 249 CG9473-PD 1..249 1..249 1325 100 Plus
MED6-PC 249 CG9473-PC 1..249 1..249 1325 100 Plus
MED6-PA 249 CG9473-PA 1..249 1..249 1325 100 Plus
MED6-PB 249 CG9473-PB 1..249 1..249 1325 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24883-PA 253 GI24883-PA 1..253 1..249 1131 83.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23233-PA 258 GL23233-PA 1..258 1..249 1144 88 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21815-PA 258 GA21815-PA 1..258 1..249 1163 88.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26214-PA 249 GM26214-PA 1..249 1..249 1335 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24525-PA 258 GJ24525-PA 1..258 1..249 1156 83.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11125-PA 256 GK11125-PA 1..256 1..249 1152 83.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24733-PA 249 GE24733-PA 1..249 1..249 1260 97.2 Plus

LD15729.hyp Sequence

Translation from 636 to 1385

> LD15729.hyp
MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETV
RMQRLGPEHLHNMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYI
IGGTVYKAPDLANVINSRILNTVVNLQSAFEEASSYARYHPNKGYTWDFS
SNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFPPPIPP
MLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSK*

LD15729.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-PE 249 CG9473-PE 1..249 1..249 1325 100 Plus
MED6-PD 249 CG9473-PD 1..249 1..249 1325 100 Plus
MED6-PC 249 CG9473-PC 1..249 1..249 1325 100 Plus
MED6-PA 249 CG9473-PA 1..249 1..249 1325 100 Plus
MED6-PB 249 CG9473-PB 1..249 1..249 1325 100 Plus