Clone LD17536 Report

Search the DGRC for LD17536

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:175
Well:36
Vector:pBS SK-
Associated Gene/TranscriptRas85D-RA
Protein status:LD17536.pep: gold
Preliminary Size:1958
Sequenced Size:1961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9375 2001-01-01 Release 2 assignment
CG9375 2001-11-29 Blastp of sequenced clone
CG9375 2003-01-01 Sim4 clustering to Release 3
Ras85D 2008-04-29 Release 5.5 accounting
Ras85D 2008-08-15 Release 5.9 accounting
Ras85D 2008-12-18 5.12 accounting

Clone Sequence Records

LD17536.complete Sequence

1961 bp (1961 high quality bases) assembled on 2001-11-29

GenBank Submission: AY089541

> LD17536.complete
CTACGTACAGCCTAGATTTCATCTTCATTTCACATACGGATTTATTGTTT
TCCTGCGCTGTTAATTGCAATTACCGCACGGCAATTAAATTGGTGCCATC
GAGGAGTACCGCCTGTCGCACCGTTAGCCGCGAAAGTGACGTGAAACGTG
CCCAGCAACTGCGCCGCGCGCGAGAAGAGAGAGGCAGAGTATTGATAGAG
AGGAGCGGAGCGGAAAAACAAGGAGGAGCTAGCTGAAGAGGCAGCAACAA
AGAAGCCCATACACGCACAGTCACCCACACAAACACACGCAACAAGCGTA
CGGAGAGAGAGACTGCATCTGCGGGCGCTTCACAAGAGAGTAAGCATCGA
TCGCGAGAAAGAGACTGTTACTGTGACATTTGACTACGGCAAATCGAAAA
CGGACGCCACAGCCAAATGACGGAATACAAACTGGTCGTCGTTGGAGCCG
GAGGCGTGGGCAAGTCCGCGCTCACCATCCAGCTAATCCAGAACCATTTC
GTGGACGAGTACGACCCCACAATCGAGGACTCTTACCGAAAGCAAGTGGT
TATCGATGGAGAGACCTGCCTGCTGGACATCCTGGACACCGCCGGCCAAG
AGGAGTACTCGGCCATGCGGGATCAGTATATGCGGACTGGCGAGGGATTC
CTGCTGGTCTTTGCCGTCAACAGTGCGAAGTCCTTCGAGGATATCGGCAC
CTACCGTGAGCAGATCAAGCGCGTAAAGGATGCCGAAGAGGTGCCCATGG
TGCTGGTGGGCAACAAATGTGATCTGGCCTCGTGGAACGTTAACAACGAG
CAGGCAAGAGAGGTGGCCAAACAGTACGGCATTCCATACATTGAGACATC
CGCCAAGACGCGCATGGGCGTGGACGATGCATTTTACACACTGGTGCGCG
AAATCCGCAAGGACAAGGACAACAAGGGGCGGAGGGGCCGCAAAATGAAC
AAGCCGAATCGTAGATTTAAATGTAAAATGCTCTAAACGGCCACGCATTG
GTTATTATTCACTTTTTATTTCTTCAAATGTCGCCTGTTTGTCTGTATGT
GCGTCGGCGAATCGCCGATCGTCCTGGGCTCGATGGTTTGTCCATTTTGG
ACACACAATGCGAAAAACACACACATGTGGGAGCGTGTTGGTCGGTGCAA
TTGTCAGATAAAAGAAGAGAAATTGTAATTAATTTAAGTAACTAGAGTTT
TATGTACGTCGAAATGATTTTGTGAATGTGTGTGTTTTGTGTCGTTTGAA
AGGCTGCGAGGCGCCCTTTTAAGAGTATTAACAATAACAAGCAAACAAAA
ACGAACGAAGCAAATCGAAAATGAAAATGAATATGTACCTCTACATAAAA
ACTATGAATACTGTTGTAACTGCCTTGGTTCAGCTGCTATATCCGTTTGT
TTTCAACCAGCACTTAACTTGATTCTATGTTGTTTGTACTTCAACAGATA
CTCCGTGCTTAAAACCGAAACGCGATGTAAACAAATATTGTGTATTTTTA
CAGCCCTGTTATCTATTGGTTTCAACCCGACAGTCATACATAAATGTAAT
CTTTTTTCGCACACACGCACGAGCAGAATTCCATTAGTATTCATCATTAG
AGAACAAACAAGCAAAAGCCGATAAGCTCACAGCAACTTTCGCACAAACG
AGTAAATTCGCTAGCCCCAAACTAGATTTATGTTCGGTTAAACACATATC
TGTGGTGCTACGATGATGAAATTATAATCCGTATGAGTTCTTGAGATTTG
CCTTTCTTTCTACTTACCATACTGACAGATCAATCGGAGAGAAAACAAAC
AGCCAATTAAATTTACATTATATAGTTTGCTTTAAGCTTTTTATACATAC
ATACATACATTTAATATTTAATTTTTTGTATTAATTTTTGCCATACAAAA
AGAAACGAAATAAATCGATTGTGTGTACTATTTAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

LD17536.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 2176 Ras85D-RA 200..2133 1..1934 9670 100 Plus
Roughened-RA 2816 Roughened-RA 719..953 426..660 320 75.7 Plus
Ras64B-RA 1702 Ras64B-RA 302..399 574..671 220 81.6 Plus
Ras64B-RA 1702 Ras64B-RA 154..264 426..536 180 77.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5336389..5337511 1933..811 5600 99.9 Minus
chr3R 27901430 chr3R 5337981..5338282 555..254 1510 100 Minus
chr3R 27901430 chr3R 5337565..5337825 815..555 1305 100 Minus
chr3R 27901430 chr3R 5338616..5338870 255..1 1275 100 Minus
chr3L 24539361 chr3L 1860530..1860764 660..426 320 75.7 Minus
chr3L 24539361 chr3L 4139440..4139528 583..671 205 82 Plus
chr2R 21145070 chr2R 11996523..11996588 634..569 195 86.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 570 CG9375-PA 1..570 417..986 2850 100 Plus
R-RC 555 CG1956-PC 10..244 426..660 320 75.7 Plus
R-RB 555 CG1956-PB 10..244 426..660 320 75.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 1958 CG9375-RA 26..1958 1..1933 9665 100 Plus
R-RC 2702 CG1956-RC 615..849 426..660 320 75.7 Plus
R-RB 2872 CG1956-RB 785..1019 426..660 320 75.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-PA 189 CG9375-PA 1..189 417..983 795 100 Plus
Ras64B-PA 192 CG1167-PA 2..164 414..899 459 63.2 Plus
R-PC 184 CG1956-PC 1..164 417..905 457 57.3 Plus
R-PB 184 CG1956-PB 1..164 417..905 457 57.3 Plus
R-PA 184 CG1956-PA 1..164 417..905 457 57.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9510560..9511683 1934..811 5620 100 Minus
3R 32079331 3R 9512153..9512454 555..254 1510 100 Minus
3R 32079331 3R 9511737..9511997 815..555 1305 100 Minus
3R 32079331 3R 9512788..9513042 255..1 1275 100 Minus
3L 28110227 3L 1860968..1861202 660..426 320 75.7 Minus
3L 28110227 3L 4140054..4140142 583..671 205 82 Plus
2R 25286936 2R 16109166..16109231 634..569 195 86.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9251391..9252514 1934..811 5620 100 Minus
3R 31820162 3R 9252984..9253285 555..254 1510 100 Minus
3R 31820162 3R 9252568..9252828 815..555 1305 100 Minus
3R 31820162 3R 9253619..9253873 255..1 1275 100 Minus
3L 28103327 3L 1860968..1861202 660..426 320 75.7 Minus
3L 28103327 3L 4140054..4140142 583..671 205 82 Plus
2R 25260384 2R 16110365..16110430 634..569 195 86.3 Minus
3L 28103327 3L 4139194..4139259 426..491 150 81.8 Plus
Blast to na_te.dros performed on 2014-11-27 15:33:57 has no hits.

LD17536.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:32:16 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5338616..5338870 1..255 100   Minus
chr3R 5337981..5338280 256..555 100 <- Minus
chr3R 5337568..5337824 556..812 100 <- Minus
chr3R 5336389..5337509 813..1933 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:18 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 417..986 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:12 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 417..986 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:30 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 417..986 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:21 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 417..986 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:16 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 417..986 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:51:07 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 23..1955 1..1933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:12 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 46..1978 1..1933 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:30 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 26..1958 1..1933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:21 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 23..1955 1..1933 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:16 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 26..1958 1..1933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:16 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9512788..9513042 1..255 100   Minus
3R 9512153..9512452 256..555 100 <- Minus
3R 9511740..9511996 556..812 100 <- Minus
3R 9510561..9511681 813..1933 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:30 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5338510..5338764 1..255 100   Minus
arm_3R 5337875..5338174 256..555 100 <- Minus
arm_3R 5337462..5337718 556..812 100 <- Minus
arm_3R 5336283..5337403 813..1933 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:34 Download gff for LD17536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9253619..9253873 1..255 100   Minus
3R 9252984..9253283 256..555 100 <- Minus
3R 9252571..9252827 556..812 100 <- Minus
3R 9251392..9252512 813..1933 100 <- Minus

LD17536.pep Sequence

Translation from 416 to 985

> LD17536.pep
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQI
KRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRM
GVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML*

LD17536.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16057-PA 189 GF16057-PA 1..189 1..189 1006 100 Plus
Dana\GF24954-PA 184 GF24954-PA 1..164 1..163 515 57.3 Plus
Dana\GF22303-PA 235 GF22303-PA 12..201 4..189 514 52.1 Plus
Dana\GF13570-PA 257 GF13570-PA 53..221 4..171 500 53.8 Plus
Dana\GF10554-PA 192 GF10554-PA 3..168 1..165 488 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17366-PA 189 GG17366-PA 1..189 1..189 1006 100 Plus
Dere\GG14553-PA 184 GG14553-PA 1..164 1..163 515 57.3 Plus
Dere\GG18572-PA 235 GG18572-PA 12..201 4..189 508 52.1 Plus
Dere\GG22302-PA 264 GG22302-PA 60..228 4..171 505 54.4 Plus
Dere\GG15195-PA 192 GG15195-PA 3..168 1..165 484 62.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19394-PA 189 GH19394-PA 1..189 1..189 932 97.9 Plus
Dgri\GH15039-PA 184 GH15039-PA 1..164 1..163 516 57.3 Plus
Dgri\GH19819-PA 265 GH19819-PA 63..231 4..171 509 55 Plus
Dgri\GH24739-PA 234 GH24739-PA 12..201 4..189 503 51.6 Plus
Dgri\GH15920-PA 192 GH15920-PA 3..168 1..165 486 62.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-PA 189 CG9375-PA 1..189 1..189 977 100 Plus
R-PC 184 CG1956-PC 1..178 1..182 515 54.1 Plus
R-PB 184 CG1956-PB 1..178 1..182 515 54.1 Plus
R-PA 184 CG1956-PA 1..178 1..182 515 54.1 Plus
Ras64B-PA 192 CG1167-PA 3..168 1..165 513 62.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22599-PA 181 GI22599-PA 1..181 1..189 878 94.2 Plus
Dmoj\GI16691-PA 184 GI16691-PA 1..164 1..163 513 56.7 Plus
Dmoj\GI14784-PA 234 GI14784-PA 12..201 4..189 509 52.6 Plus
Dmoj\GI20407-PA 267 GI20407-PA 63..231 4..171 502 53.8 Plus
Dmoj\GI16572-PA 192 GI16572-PA 3..168 1..165 488 62.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22227-PA 189 GL22227-PA 1..189 1..189 931 97.4 Plus
Dper\GL19979-PA 262 GL19979-PA 60..228 4..171 513 55 Plus
Dper\GL12826-PA 174 GL12826-PA 11..160 16..164 465 60 Plus
Dper\GL11660-PA 182 GL11660-PA 1..175 1..174 380 42.3 Plus
Dper\GL23727-PA 200 GL23727-PA 12..200 4..189 348 40.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21740-PA 189 GA21740-PA 1..189 1..189 931 97.4 Plus
Dpse\GA15150-PA 184 GA15150-PA 1..164 1..163 516 57.3 Plus
Dpse\GA21063-PA 262 GA21063-PA 60..228 4..171 513 55 Plus
Dpse\GA15484-PA 201 GA15484-PA 12..201 4..189 507 52.1 Plus
Dpse\GA11132-PA 192 GA11132-PA 3..168 1..165 483 62.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26252-PA 189 GM26252-PA 1..189 1..189 1006 100 Plus
Dsec\GM14161-PA 184 GM14161-PA 1..164 1..163 515 57.3 Plus
Dsec\GM12716-PA 235 GM12716-PA 12..201 4..189 508 52.1 Plus
Dsec\GM20091-PA 264 GM20091-PA 60..228 4..171 507 54.4 Plus
Dsec\GM14626-PA 254 GM14626-PA 83..230 19..165 433 57.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Ras85D-PA 189 GD20791-PA 1..189 1..189 1006 100 Plus
Dsim\R-PA 184 GD13432-PA 1..164 1..163 515 57.3 Plus
Dsim\GD16321-PA 235 GD16321-PA 12..201 4..189 508 52.1 Plus
Dsim\GD25569-PA 264 GD25569-PA 60..228 4..171 507 54.4 Plus
Dsim\Ras64B-PA 166 GD13815-PA 2..142 26..165 431 59.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ras1-PA 189 GJ23844-PA 1..189 1..189 991 98.4 Plus
Dvir\GJ12943-PA 184 GJ12943-PA 1..164 1..163 513 56.7 Plus
Dvir\GJ18826-PA 234 GJ18826-PA 12..201 4..189 509 52.6 Plus
Dvir\GJ20079-PA 267 GJ20079-PA 63..231 4..171 499 53.8 Plus
Dvir\GJ12824-PA 192 GJ12824-PA 3..168 1..165 485 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13838-PA 189 GK13838-PA 1..189 1..189 935 97.9 Plus
Dwil\GK20561-PA 184 GK20561-PA 1..164 1..163 516 57.3 Plus
Dwil\GK24932-PA 235 GK24932-PA 12..201 4..189 508 52.1 Plus
Dwil\GK12838-PA 192 GK12838-PA 3..168 1..165 488 62.7 Plus
Dwil\GK21923-PA 159 GK21923-PA 1..155 1..154 341 43.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24771-PA 189 GE24771-PA 1..189 1..189 1006 100 Plus
Dyak\GE20907-PA 184 GE20907-PA 1..164 1..163 515 57.3 Plus
Dyak\GE16885-PA 235 GE16885-PA 12..201 4..189 508 52.1 Plus
Dyak\GE14098-PA 264 GE14098-PA 60..228 4..171 505 54.4 Plus
Dyak\GE21414-PA 192 GE21414-PA 3..168 1..165 484 62.7 Plus

LD17536.hyp Sequence

Translation from 416 to 985

> LD17536.hyp
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQI
KRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRM
GVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML*

LD17536.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-PA 189 CG9375-PA 1..189 1..189 977 100 Plus
R-PC 184 CG1956-PC 1..178 1..182 515 54.1 Plus
R-PB 184 CG1956-PB 1..178 1..182 515 54.1 Plus
R-PA 184 CG1956-PA 1..178 1..182 515 54.1 Plus
Ras64B-PA 192 CG1167-PA 3..168 1..165 513 62.7 Plus