Clone LD17773 Report

Search the DGRC for LD17773

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:177
Well:73
Vector:pBS SK-
Associated Gene/TranscriptCG3919-RB
Protein status:LD17773.pep: gold
Preliminary Size:1547
Sequenced Size:1376

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3919 2001-01-01 Release 2 assignment
CG3919 2001-11-29 Blastp of sequenced clone
CG3919 2003-01-01 Sim4 clustering to Release 3
CG3919 2008-04-29 Release 5.5 accounting
CG3919 2008-08-15 Release 5.9 accounting
CG3919 2008-12-18 5.12 accounting

Clone Sequence Records

LD17773.complete Sequence

1376 bp (1376 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069455

> LD17773.complete
TTCGAATCAGTCTAGTGCTCATGTGCTTTAAAATCAAGAACAATTGCTAT
TTGAAATTGCAACATTCATTTACAACTGCATCACTTGTTGGCAGCAGCAC
GAAATCGCAGTGTTCAAAGTTGCTAAACACTTGTAATAGCAGCAACTCCG
GCGTCCACGCCAACAACTGCCGCGTGCACGGAAGCAACGAGCGGCTTGAG
CCCGAACTTAATAAGCCAAAACTCGTGATAAAAGCACTGACATCGATTAA
TTGGAGCATTTTTAAACCTAATTCACTTTTTATATATGAAATGAATACAC
GCCGTCGGTCCATAGCTCCACCACCGAACGTTTACGCCATCAATGCCAAA
ATATGTCATTTGGTGAAACTACATCCTTGTCTTTACGATCGTCACGATGA
CAACTACTTGCGGAAATCGACTGTGAAAAATGCGTGGAAGGAAATATCCA
ATGAGATGCGAAATTCGGTTAAAAGCTGCAAGGAACGTTGGCGCAACATT
CGCTCCAGCTATGCCCGCTCAATAAAGTTGCATCACGGTGCGAATACGTA
CTATCTTAACAGCGAGCTGAAGTTCCTGCAAAAGCACATCACTCCCGGAG
TGCCCGTTCCGCTCAGAGGTCGTAGGTCAAGACCCAAGGGACAGGAGGAG
CACGACGAAGGGGATCCCGAAACTCCCGTAGAGGCAATCCTCGAGATGGT
GCACTCCCCGAGCTTTCTGAATTCGGAGCATGCGCAGAGCCGTCACAGCA
CCGACCCTGCATCGGCGACGGACGTTGAGGCAACACAATTTAATAATGAA
CCATCATCAATCATGGATTTCGAGGACACGGTCCCGGCAGAAATGCGCAC
AGAGAGCGACAGCAGTGAGAAGGAGGCCAAGACATCAACCCGCTGTATTG
AAGCATTGCCAATCATGGATTTCGATGACGCATTCCTGCAGGGACTGCGT
CCCGAAATCAAGCACATGAACTTCCACCAGAAGCTGTACTTCAAGCGACG
TGTGTACGACCTGCTTGGCGAGATATTCCATTCCGAGCAGTCAGCCTCAT
CAACCCACCCAGCGCAGCCGCATCCCAGGGAGAATGTCAATGGAACGCTA
TCCACTACCTCGAGTCTCTCCTCGGCGAATCCACTACAGCACATGGGACT
TATGCTGCAGCTGCCAAAGCTGGTGTCCAAGGCATCCAAAGATTTGTAGC
TTGCGAACTGCTCATTGAACAGCTTTAATACACTGATATCAAATTTATGT
ACAGTACATAGGACAAATAACATTTTAAGTTGTTTTTAGAAATGTTCCCA
TAATGTATAAACAGAAAAATGTGAAGTTGAAACTAAATAAATAAATTTTT
CTAAATTTAAAAAAAAAAAAAAAAAA

LD17773.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 1795 CG3919-RB 434..1795 1..1362 6810 100 Plus
CG3919.d 1754 CG3919.d 345..1225 1..881 4405 100 Plus
CG3919.a 1563 CG3919.a 154..1034 1..881 4405 100 Plus
CG3919.d 1754 CG3919.d 1269..1754 877..1362 2415 99.7 Plus
CG3919.a 1563 CG3919.a 1078..1563 877..1362 2415 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14402327..14402805 880..1358 2380 99.8 Plus
chr3L 24539361 chr3L 14401568..14401884 464..780 1510 98.4 Plus
chr3L 24539361 chr3L 14400700..14400974 2..276 1360 99.6 Plus
chr3L 24539361 chr3L 14401154..14401345 277..468 945 99.5 Plus
chr3L 24539361 chr3L 14402106..14402209 778..881 520 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 909 CG3919-PB 1..909 291..1199 4545 100 Plus
CG3919-RC 957 CG3919-PC 1..591 291..881 2955 100 Plus
CG3919-RC 957 CG3919-PC 635..957 877..1199 1600 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 1358 CG3919-RB 1..1358 1..1358 6790 100 Plus
CG3919-RC 1406 CG3919-RC 1..881 1..881 4405 100 Plus
CG3919-RC 1406 CG3919-RC 925..1406 877..1358 2395 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PB 302 CG3919-PB 1..302 291..1196 1538 100 Plus
CG3919-PC 318 CG3919-PC 1..318 291..1196 1511 95 Plus
CG4404-PA 308 CG4404-PA 15..98 342..578 178 38.1 Plus
CG3838-PB 435 CG3838-PB 58..140 342..578 165 41 Plus
CG3838-PA 435 CG3838-PA 58..140 342..578 165 41 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14412254..14412736 880..1362 2415 100 Plus
3L 28110227 3L 14411495..14411811 464..780 1570 99.7 Plus
3L 28110227 3L 14410626..14410901 1..276 1380 100 Plus
3L 28110227 3L 14411081..14411272 277..468 960 100 Plus
3L 28110227 3L 14412033..14412136 778..881 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14405354..14405836 880..1362 2415 100 Plus
3L 28103327 3L 14404595..14404911 464..780 1570 99.6 Plus
3L 28103327 3L 14403726..14404001 1..276 1380 100 Plus
3L 28103327 3L 14404181..14404372 277..468 960 100 Plus
3L 28103327 3L 14405133..14405236 778..881 520 100 Plus
Blast to na_te.dros performed 2014-11-26 19:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 6810..6909 11..103 132 65.3 Plus

LD17773.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:19:33 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14402329..14402775 882..1328 99 -> Plus
chr3L 14402108..14402209 780..881 100 -> Plus
chr3L 14401573..14401883 469..779 98 -> Plus
chr3L 14401154..14401345 277..468 99 -> Plus
chr3L 14400699..14400974 1..276 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:52:30 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 291..1199 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:23:27 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 291..1199 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:28 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 291..1199 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:05 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 291..1199 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:33 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 291..1199 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:58:35 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:23:27 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:28 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:06 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:33 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..1358 1..1358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:19:33 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14412256..14412732 882..1358 100   Plus
3L 14412035..14412136 780..881 100 -> Plus
3L 14411500..14411810 469..779 100 -> Plus
3L 14411081..14411272 277..468 100 -> Plus
3L 14410626..14410901 1..276 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:28 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14405356..14405832 882..1358 100   Plus
arm_3L 14405135..14405236 780..881 100 -> Plus
arm_3L 14404600..14404910 469..779 100 -> Plus
arm_3L 14404181..14404372 277..468 100 -> Plus
arm_3L 14403726..14404001 1..276 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:26:31 Download gff for LD17773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14405356..14405832 882..1358 100   Plus
3L 14405135..14405236 780..881 100 -> Plus
3L 14404600..14404910 469..779 100 -> Plus
3L 14404181..14404372 277..468 100 -> Plus
3L 14403726..14404001 1..276 100 -> Plus

LD17773.hyp Sequence

Translation from 2 to 1198

> LD17773.hyp
RISLVLMCFKIKNNCYLKLQHSFTTASLVGSSTKSQCSKLLNTCNSSNSG
VHANNCRVHGSNERLEPELNKPKLVIKALTSINWSIFKPNSLFIYEMNTR
RRSIAPPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISN
EMRNSVKSCKERWRNIRSSYARSIKLHHGANTYYLNSELKFLQKHITPGV
PVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHST
DPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKTSTRCIE
ALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSASS
THPAQPHPRENVNGTLSTTSSLSSANPLQHMGLMLQLPKLVSKASKDL*

LD17773.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PB 302 CG3919-PB 1..302 97..398 1591 100 Plus
CG3919-PC 318 CG3919-PC 1..318 97..398 1564 95 Plus
CG4404-PA 308 CG4404-PA 15..98 114..192 178 38.1 Plus
CG3838-PB 435 CG3838-PB 58..140 114..192 165 41 Plus
CG3838-PA 435 CG3838-PA 58..140 114..192 165 41 Plus

LD17773.pep Sequence

Translation from 20 to 1198

> LD17773.pep
MCFKIKNNCYLKLQHSFTTASLVGSSTKSQCSKLLNTCNSSNSGVHANNC
RVHGSNERLEPELNKPKLVIKALTSINWSIFKPNSLFIYEMNTRRRSIAP
PPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSV
KSCKERWRNIRSSYARSIKLHHGANTYYLNSELKFLQKHITPGVPVPLRG
RRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASAT
DVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKTSTRCIEALPIMD
FDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQP
HPRENVNGTLSTTSSLSSANPLQHMGLMLQLPKLVSKASKDL*

LD17773.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24603-PA 302 GF24603-PA 1..298 91..391 880 57.1 Plus
Dana\GF20883-PA 333 GF20883-PA 8..93 106..186 182 38.4 Plus
Dana\GF15373-PA 460 GF15373-PA 137..242 107..205 178 38.7 Plus
Dana\GF22772-PA 437 GF22772-PA 60..143 107..186 162 40.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15683-PA 238 GG15683-PA 1..197 91..287 866 83.4 Plus
Dere\GG19531-PA 313 GG19531-PA 8..148 106..222 201 32.6 Plus
Dere\GG21572-PA 459 GG21572-PA 137..242 107..205 169 37.7 Plus
Dere\GG10039-PA 452 GG10039-PA 71..154 107..186 167 40.5 Plus
Dere\GG13727-PA 1013 GG13727-PA 3..97 103..190 159 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17100-PA 369 GH17100-PA 46..369 102..392 547 41.4 Plus
Dgri\GH10040-PA 369 GH10040-PA 46..369 102..392 547 41.4 Plus
Dgri\GH17618-PA 356 GH17618-PA 8..93 106..186 187 39.5 Plus
Dgri\GH14459-PA 1131 GH14459-PA 4..97 105..190 167 33 Plus
Dgri\GH10671-PA 438 GH10671-PA 68..151 107..186 163 39.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PB 302 CG3919-PB 1..302 91..392 1591 100 Plus
CG3919-PC 318 CG3919-PC 1..318 91..392 1564 95 Plus
CG4404-PA 308 CG4404-PA 15..98 108..186 178 38.1 Plus
CG3838-PB 435 CG3838-PB 58..140 108..186 165 41 Plus
CG3838-PA 435 CG3838-PA 58..140 108..186 165 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11704-PA 367 GI11704-PA 32..133 102..200 347 59.8 Plus
Dmoj\GI11704-PA 367 GI11704-PA 241..367 249..392 256 44.2 Plus
Dmoj\GI16274-PA 406 GI16274-PA 8..93 106..186 182 39.5 Plus
Dmoj\GI13601-PA 1007 GI13601-PA 2..99 103..193 162 31.6 Plus
Dmoj\GI11040-PA 462 GI11040-PA 78..161 107..186 159 39.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21014-PA 286 GL21014-PA 23..257 96..367 460 40.7 Plus
Dper\GL22959-PA 362 GL22959-PA 8..93 106..186 185 39.5 Plus
Dper\GL18916-PA 444 GL18916-PA 58..141 107..186 165 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17773-PA 286 GA17773-PA 23..257 96..367 457 40.4 Plus
Dpse\GA18161-PA 341 GA18161-PA 8..93 106..186 185 39.5 Plus
Dpse\GA17722-PA 445 GA17722-PA 58..141 107..186 164 39.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25465-PA 306 GM25465-PA 5..306 87..392 1344 82.4 Plus
Dsec\GM11525-PA 299 GM11525-PA 8..93 106..186 185 36 Plus
Dsec\GM23328-PA 459 GM23328-PA 137..242 107..205 170 37.7 Plus
Dsec\GM17547-PA 441 GM17547-PA 64..147 107..186 167 40.5 Plus
Dsec\GM24548-PA 636 GM24548-PA 7..97 107..190 154 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24528-PA 224 GD24528-PA 8..93 106..186 188 36 Plus
Dsim\GD21703-PA 459 GD21703-PA 137..242 107..205 170 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11378-PA 358 GJ11378-PA 20..358 86..392 582 42.2 Plus
Dvir\GJ13939-PA 1077 GJ13939-PA 2..97 103..191 173 34.4 Plus
Dvir\GJ18309-PA 449 GJ18309-PA 68..151 107..186 164 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12702-PA 371 GK12702-PA 11..118 102..204 364 61.1 Plus
Dwil\GK12702-PA 371 GK12702-PA 244..370 284..391 263 46.5 Plus
Dwil\GK16390-PA 377 GK16390-PA 8..93 106..186 200 40.7 Plus
Dwil\GK23864-PA 441 GK23864-PA 71..154 107..186 169 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22013-PA 321 GE22013-PA 1..321 91..392 1237 78.9 Plus
Dyak\GE16190-PA 334 GE16190-PA 8..93 106..186 190 38.4 Plus
Dyak\GE12593-PA 459 GE12593-PA 112..242 82..205 171 32.8 Plus
Dyak\GE18854-PA 445 GE18854-PA 69..152 107..186 167 40.5 Plus
Dyak\GE20022-PA 1023 GE20022-PA 3..97 103..190 159 33.7 Plus