Clone LD18251 Report

Search the DGRC for LD18251

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:182
Well:51
Vector:pBS SK-
Associated Gene/TranscriptBtk29A-RA
Protein status:LD18251.pep: gold
Preliminary Size:4786
Sequenced Size:5143

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8049 2003-01-01 Sim4 clustering to Release 3
CG8049 2003-01-13 Blastp of sequenced clone
Btk29A 2008-04-29 Release 5.5 accounting
Btk29A 2008-08-15 Release 5.9 accounting
snRNA:U6:96Aa 2008-08-15 Release 5.9 accounting
Btk29A 2008-12-18 5.12 accounting
snRNA:U6:96Aa 2008-12-18 5.12 accounting

Clone Sequence Records

LD18251.complete Sequence

5143 bp (5143 high quality bases) assembled on 2003-01-13

GenBank Submission: AY069457

> LD18251.complete
TTGGAACGATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACG
CAAAATCGTGAAGCGTTCCACATTTTTTTTTCCGTCGCCGCTTCTTGACC
GCTTTAAATTATTTGGCGGATTTGCTTTGTTCACGCTCCTCAAGTTGCTG
GATGTTTTTCGGCTTTAACATTTACCTTTCGGAATCAGGTCAAAGCGGTT
GCTTTCTTTTGGCATTGCCACGCCCCAAACGGTTATATTTTGTATTCGAT
TTTTTACTTTGGCAGCGCTTTCCTTTCGCCCGCGGGCAGCATCTTAACTC
TTTTCGGGATTTTTGCAGGGTCAGGCAAGGTCAATATATCACCGCTTTAC
ATATTCATTTATTCATTTGTCTGCTTTTTTTTGTGTAGTTTACGACAAGT
AAAAGTTGAACTGTTTTTTTTTTTCGTTTTTGTGTCAACACTCACATGTC
GTTAAAGTCGAAATTTTAATGCCAATTGTGTAAGGCGTGAAAATTTCACT
TTTCCAATTCGACACGAGTTTCAAGCTGCAATCTGTAGTACTAATAACTG
GCAAATCAACAACAAAGAGCCGTGGCTTAAAAACTGTGATTCAATCAAGT
ATAAATACTTCTATTGTTTTCGGATTTCCCACGACTTTTCATCAGGCTTT
TAACTTTGAATTTTCTCAAATAAACTATTCTTTGCCCTTGGTATTTGAAC
TTAAGCGTGGAGTTTAACTTAATGGCATAAAGTATGCATTTATAAGGGTA
ATATTTTGCACTTAACCAACTAACAAACAAGTTTGATTTATTTCTTATAC
AATTTAAATCATGTTTTACAACTACACCCCTTCGTTTTGCTAACCTTTAT
GTACTTCTACATAATTTAGAGCACACATTTCCAATTTAATTCCATCCACA
CCTGATCATTTCGATATCGGTTTAACTGTTTACCAAGCTTCTACCAATCA
ATCTGTAAATAGACCTTAATTTTGATACCGCACCTCGCCCATTTATGCGT
AAACCGCACGCCGAGCATCGTTAATCATTTTGAAAGTTCATTAGATTTCG
TTGGCTTGTTCCACTGAATTAAGGAACCAACTGGGTAGAAACGACTTGAA
ATTGATGTTAATTATGTTGCCAACAGTTGCTACTAAAATTAAAAAAAAAA
ATAATAGTATAAAGAAGAGACACCGAAGCGAGTGTATGCGTTACAGTGGA
GCTCAATGAACTGCTCCTAGGTCTCCTCTGCCCACGGCTATAGATTGTTG
TCTCAGATTGCTATTGATGGCGTTTTTTCACTTGACTGGGTGCGTTTTGT
TTGGTTCAAGGCTTCCACTTGCCTAATCTGTAGGTAAATGAAAATTGTTC
TACTTACTCCAAAGCCTCATAAATCAATTTTGGTTTTTAAGTTTGTATAC
GTCATTAGCTTCTACCGCATGGAAATTGTTATTAATCTTCGGTGCTGCTG
CTGCTGCGACGATTGATTCACTCGAACAATTACAATGCGAAAATCAATGA
AGCTGATGATGATTGTCGATAATGATGGGGGCAACCTCAACCGACTTTGG
CTGCAGCATCATTAGCATTTGCATCAGGCTAACCCCGATTCTTTAGCAGC
ATTGCTCATCTGCATTTTTAAGGAAATTCTCGAGTAATTCGCCATAAAAA
CGAGACACGTTTGATGTTCTGCAAACAAAGCATAAATCAAATGCAGAATG
TGTTTGATTTATGGGGGTTTCATGTGTGCATACATATGTACGTGTGTAGT
TAAAAGCATGCCACCAATATTTATACTCAATTGCCAAAACAGGAATTGAA
ATTTCGTCGGCTTCCTCTGTGGCGTATTTTGTTGTTTTGATTGATTGTTT
CAATGGTCAGGCATTTTTTTTTTGGTATTTCGCCTTTTTGGCAATTAAAG
CATCCATGAATTTGATGGACTTTAAGTAGTATTGTAGTTTGCTTCCGCAA
ACGCGTCGTACTTGAGCAGAAGCTCGTTAAGTTGCTGCTGAACCTAATGT
ATTCATGTGTGACTTTAAGAAATCGCAATTACAAATAGCTGCTGCAAAGC
AAAAGCAAAAATAAGCACAAATCGCTTCGAATGGCCAAAAAAACAAAAAA
AAACCGCTTGCCCAACTCAACTTTAATGACCCACAATGCGTCAATGCTCA
AACAAATCTATTTCTCCCCCTGTCAGCAGTAAAATTTCAATTAAAATAGT
GGAAAAAAAAAATAAATCGAGTTAAAAAACGCGTGTGCAACGCCAGCGTT
TTTGGTTAGCCATCTCAGCCGTTCCCAAATGATTCCCTGCGTGAGTTTGG
CCGAAACGAGCGTCATTGGCAACATGAAGGAGCGGGTCAAGGAAATGAAG
GTGTTCGGCTGCCGACTCAACTTCTGGAACCACATTGGTCACAGCCTGAC
CAGTTCCAAAACCAAAGAAGGCAACGGCAGTTCTCCAGCCCAGAATTCAA
CGCGCAGCATCAGTCCCAACAGCTCCACGACCAACAGTCAGTTTAGCTTG
CAGCACAACAGCTCGGGGAGTCTCGGCGGAGGAGTGGGCGGCGGATTGGG
AGGCGGAGGCAGCCTTGGCCTAGGCGGCGGAGGAGGAGGTGGCGGCAGTT
GCACGCCCACATCGCTACAGCCTCAGTCCTCGCTGACAACTTTCAAGCAG
TCCCCAACTCTATTGAACGGCAACGGAACTCTATTGGATGCCAATATGCC
TGGCGGTATACCCACTCCCGGAACACCAAATTCCAAAGCCAAGGACAACT
CCCACTTTGTCAAGCTGGTGGTGGCTCTCTATCCATTCAAGGCCATCGAA
GGCGGCGATTTATCGCTGGAAAAGAATGCCGAATACGAAGTGATAGATGA
CTCACAAGAGCACTGGTGGAAGGTCAAAGATGCCTTGGGGAATGTCGGCT
ATATACCCAGCAACTATGTCAAGCCGAAGGCTCTTCTGGGCCTGGAGCGC
TATGAATGGTATGTGGGCGACATGTCACGACAGAGAGCCGAATCGCTGCT
GAAGCAAGGTGATAAGGAGGGCTGCTTTGTGGTCAGGAAGTCATCGACCA
AGGGTCTCTACACACTATCGCTGCATACCAAAGTTCCACAGTCGCATGTG
AAGCACTACCACATCAAGCAAAATGCTCGCTGCGAGTATTATTTGAGTGA
GAAGCACTGCTGTGAAACAATTCCGGATCTGATTAACTACCATCGCCACA
ACTCTGGGGGTTTGGCTTGCCGACTCAAATCCTCGCCCTGCGATCGCCCA
GTTCCACCGACGGCGGGATTGTCCCACGACAAATGGGAGATCCATCCGAT
GGAACTGATGCTGATGGAGGAGCTTGGATCGGGACAGTTTGGTGTTGTGC
GGCGCGGCAAGTGGCGTGGGTCTATCGACACAGCGGTCAAGATGATGAAG
GAAGGAACCATGTCCGAGGACGATTTCATTGAGGAGGCCAAGGTGATGAC
CAAGCTGCAGCATCCAAATCTTGTGCAGCTATATGGCGTCTGCTCCAAGC
ACCGGCCCATCTACATTGTGACCGAGTACATGAAGCACGGATCCTTGTTG
AATTACTTGCGACGGCATGAGAAGACCCTGATTGGTAATATGGGTCTACT
CCTTGACATGTGCATACAGGTTAGCAAGGGAATGACCTACCTGGAGCGCC
ATAACTACATTCACCGGGATCTGGCTGCCCGCAACTGTCTCGTGGGTTCC
GAGAATGTCGTTAAAGTGGCCGACTTTGGATTGGCCCGATACGTTCTCGA
CGATCAGTATACCAGCTCTGGCGGAACCAAGTTCCCCATCAAGTGGGCCC
CGCCCGAAGTGCTCAACTACACGCGCTTCTCCTCTAAGAGCGATGTGTGG
GCATACGGTGTGCTGATGTGGGAGATCTTCACTTGCGGCAAGATGCCATA
CGGTCGCCTAAAGAATACCGAGGTTGTGGAGCGTGTGCAGCGCGGAATTA
TCCTAGAAAAACCAAAGTCGTGTGCCAAGGAGATTTATGATGTCATGAAG
TTGTGCTGGTCACATGGACCCGAGGAGCGTCCCGCTTTCCGTGTGCTCAT
GGATCAGCTGGCTCTTGTGGCCCAAACGCTAACCGACTAAGGAGCGGACC
AGATTGCGGCACCCATCGCCTGAAATTAACACGCACTGAACACACTGAAG
CATCTTAAGATATTGAAGAACGTTAAAGGCATTACATTTAAGGTTACAAA
AGCGGCGAAAGAAAGATATATTTAGATTTATACATATATGTATATGAAGC
ATAAGATTTAGTTAAGCGCGAGCCAGTTTACATTACGGCACAAGCCCCAT
ATGATTATGGTATATTTGGATTATATGATAGAGCTAGAGCTGAGCAAATG
ATATCATTATGTTTATGAACGCGTTAACTGTTAGACAATGAGATACGAAG
CGCAACAACTGACAGTCACATATAGTAACTATATTAAATGAGAAAACGGA
AATGCATTAAAGTATAGAGAACTGTAGTTAATAGTCAAATTTTTGATACA
TTTCACATACCGAAAGCGATATAAAAAAATTATAACGATACATGCATATG
ATACGATATTTAAATGTGCTTTTTTAAATAGCGAGCCACTGTGCTAAGTA
AAATATGATTATCTCTAAAGAATGATAGAAACAAACAAACAAGAAAACTG
ATTATGCATTAAATATTAAATGTAAGCCTCAAGTCGAAAGCGAAATGTTT
GCACAACTGATAAAGGATGAAGGAACCGAAGGATGATAAGAAAAGAGTTC
GCCAAGAAACATAAACGATTTTTAGACTAGATTTGTACGTGCGTAGTTTA
AGTTTTGTGATTTATTGTTTAATTCTTGCAGACGATTTTTATTTTTATTT
AATTTTGATCTTGCGATGGCATCACCCACGCTCACAGTATGAATCAAGTA
CGGTATAATTACGAGAAATTTATACGTTATGCTTTATATTTTAACTGAAT
TCTTTCGTTTTTTTGCAATGTCTATGCGATATAAATCTATATATCTATAC
ACATATTTTACCCTATTTTTATGAACGTTTTACTTAATTAATTTTATCAT
TTGATTAAGCAACCAGAAATGCAAAAGAGAAAAGAAAAAACAGAAAATCA
AATAAAATGTACGATAAACATTTAAAAAAAAAAAAAAAAAAAA

LD18251.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A.l 5420 Btk29A.l 372..5420 76..5124 25245 100 Plus
Btk29A.j 5898 Btk29A.j 123..5171 76..5124 25245 100 Plus
Btk29A-RF 5173 Btk29A-RF 125..5173 76..5124 25245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8270889..8273241 2421..76 11365 99.1 Minus
chr2L 23010047 chr2L 8258449..8259578 5123..3992 5440 99.1 Minus
chr2L 23010047 chr2L 8259848..8260623 3860..3085 3880 100 Minus
chr2L 23010047 chr2L 8261409..8261616 2626..2419 1010 99 Minus
chr2L 23010047 chr2L 8259638..8259774 3993..3857 685 100 Minus
chr2L 23010047 chr2L 8260885..8261017 2955..2823 665 100 Minus
chr2L 23010047 chr2L 8260682..8260810 3084..2956 645 100 Minus
chr2L 23010047 chr2L 8261226..8261346 2744..2624 575 98.3 Minus
chr2L 23010047 chr2L 8261081..8261163 2824..2742 400 98.8 Minus
chr3R 27901430 chr3R 20379366..20379444 1..79 395 100 Plus
chr3R 27901430 chr3R 20379970..20380048 1..79 395 100 Plus
chr3R 27901430 chr3R 20380493..20380571 1..79 395 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-RF 1812 CG8049-PF 1..1812 2279..4090 9060 100 Plus
Btk29A-RA 1812 CG8049-PA 1..1812 2279..4090 9060 100 Plus
Btk29A-RC 1812 CG8049-PC 1..1812 2279..4090 9060 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
snRNA:U6:96Aa-RA 107 CR31379-RA 31..107 1..77 385 100 Plus
snRNA:U6:96Ab-RA 107 CR32867-RA 31..107 1..77 385 100 Plus
snRNA:U6:96Ac-RA 107 CR31539-RA 31..107 1..77 385 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-RF 4992 CG8049-RF 1..4992 132..5123 24960 100 Plus
Btk29A-RC 3279 CG8049-RC 333..3279 2177..5123 14735 100 Plus
Btk29A-RA 4026 CG8049-RA 333..3276 2180..5123 14720 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-PF 603 CG8049-PF 1..603 2279..4087 3037 100 Plus
Btk29A-PA 603 CG8049-PA 1..603 2279..4087 3037 100 Plus
Btk29A-PC 603 CG8049-PC 1..603 2279..4087 3037 100 Plus
Btk29A-PG 565 CG8049-PG 5..565 2405..4087 2792 99.5 Plus
Btk29A-PE 786 CG8049-PE 215..786 2354..4087 2785 96.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8271935..8274280 2421..76 11730 100 Minus
2L 23513712 2L 8259504..8260636 5124..3992 5665 100 Minus
2L 23513712 2L 8260906..8261681 3860..3085 3880 100 Minus
2L 23513712 2L 8262475..8262682 2626..2419 1040 100 Minus
2L 23513712 2L 8260696..8260832 3993..3857 685 100 Minus
2L 23513712 2L 8261943..8262075 2955..2823 665 100 Minus
2L 23513712 2L 8261740..8261868 3084..2956 645 100 Minus
2L 23513712 2L 8262284..8262404 2744..2624 605 100 Minus
2L 23513712 2L 8262139..8262221 2824..2742 415 100 Minus
3R 32079331 3R 24556118..24556196 1..79 395 100 Plus
3R 32079331 3R 24556722..24556800 1..79 395 100 Plus
3R 32079331 3R 24557245..24557323 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8271935..8274280 2421..76 11730 100 Minus
2L 23513712 2L 8259504..8260636 5124..3992 5665 100 Minus
2L 23513712 2L 8260906..8261681 3860..3085 3880 100 Minus
2L 23513712 2L 8262475..8262682 2626..2419 1040 100 Minus
2L 23513712 2L 8260696..8260832 3993..3857 685 100 Minus
2L 23513712 2L 8261943..8262075 2955..2823 665 100 Minus
2L 23513712 2L 8261740..8261868 3084..2956 645 100 Minus
2L 23513712 2L 8262284..8262404 2744..2624 605 100 Minus
2L 23513712 2L 8262139..8262221 2824..2742 415 100 Minus
3R 31820162 3R 24298076..24298154 1..79 395 100 Plus
3R 31820162 3R 24297553..24297631 1..79 395 100 Plus
3R 31820162 3R 24296949..24297027 1..79 395 100 Plus
Blast to na_te.dros performed 2014-11-26 22:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 746..874 347..471 140 62.1 Plus
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 394..462 4276..4208 128 68.6 Minus

LD18251.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:50:22 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8270890..8273248 69..2420 98   Minus
chr2L 8261409..8261614 2421..2626 99 <- Minus
chr2L 8261227..8261343 2627..2743 98 <- Minus
chr2L 8261081..8261161 2744..2824 98 <- Minus
chr2L 8260885..8261015 2825..2955 100 <- Minus
chr2L 8260682..8260810 2956..3084 100 <- Minus
chr2L 8259851..8260623 3085..3857 100 <- Minus
chr2L 8259640..8259773 3858..3991 100 <- Minus
chr2L 8258449..8259578 3992..5123 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:24:49 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..1812 2279..4090 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:18 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..1812 2279..4090 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:48 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RC 1..1812 2279..4090 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:05 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..1812 2279..4090 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:22 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RC 1..1812 2279..4090 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:05:45 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
snRNA:U6:96Ac-RA 31..107 1..77 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:24:48 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..5055 71..5123 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:18 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..5055 71..5123 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:48 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..4992 132..5123 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:06 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..5055 71..5123 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:22 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 1..4992 132..5123 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:50:22 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8271936..8274287 69..2420 99   Minus
2L 8262475..8262680 2421..2626 100 <- Minus
2L 8262285..8262401 2627..2743 100 <- Minus
2L 8262139..8262219 2744..2824 100 <- Minus
2L 8261943..8262073 2825..2955 100 <- Minus
2L 8261740..8261868 2956..3084 100 <- Minus
2L 8260909..8261681 3085..3857 100 <- Minus
2L 8260698..8260831 3858..3991 100 <- Minus
2L 8259505..8260636 3992..5123 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:48 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8271936..8274287 69..2420 99   Minus
arm_2L 8262475..8262680 2421..2626 100 <- Minus
arm_2L 8262285..8262401 2627..2743 100 <- Minus
arm_2L 8262139..8262219 2744..2824 100 <- Minus
arm_2L 8261943..8262073 2825..2955 100 <- Minus
arm_2L 8261740..8261868 2956..3084 100 <- Minus
arm_2L 8260909..8261681 3085..3857 100 <- Minus
arm_2L 8260698..8260831 3858..3991 100 <- Minus
arm_2L 8259505..8260636 3992..5123 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:32 Download gff for LD18251.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8271936..8274287 69..2420 99   Minus
2L 8262475..8262680 2421..2626 100 <- Minus
2L 8262285..8262401 2627..2743 100 <- Minus
2L 8262139..8262219 2744..2824 100 <- Minus
2L 8261943..8262073 2825..2955 100 <- Minus
2L 8261740..8261868 2956..3084 100 <- Minus
2L 8260909..8261681 3085..3857 100 <- Minus
2L 8260698..8260831 3858..3991 100 <- Minus
2L 8259505..8260636 3992..5123 100 <- Minus

LD18251.pep Sequence

Translation from 2278 to 4089

> LD18251.pep
MIPCVSLAETSVIGNMKERVKEMKVFGCRLNFWNHIGHSLTSSKTKEGNG
SSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGG
GGGGGGSCTPTSLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTP
NSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVK
DALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCF
VVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPD
LINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELG
SGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQ
LYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSK
GMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGT
KFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVV
ERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQT
LTD*

LD18251.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15268-PA 786 GF15268-PA 213..786 25..603 2800 94.8 Plus
Dana\GF10512-PA 1708 GF10512-PA 262..699 162..599 920 42.3 Plus
Dana\GF11039-PA 518 GF11039-PA 52..501 145..594 916 42 Plus
Dana\GF24724-PA 554 GF24724-PA 70..534 124..590 863 40.5 Plus
Dana\GF16628-PA 727 GF16628-PA 349..722 217..597 599 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23459-PA 781 GG23459-PA 210..781 25..603 2813 96.4 Plus
Dere\GG15861-PA 1619 GG15861-PA 190..627 162..599 923 42.3 Plus
Dere\GG23190-PA 517 GG23190-PA 51..500 145..594 911 41.7 Plus
Dere\GG14172-PA 552 GG14172-PA 68..532 124..590 860 40.5 Plus
Dere\GG17208-PA 723 GG17208-PA 350..718 222..597 598 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10183-PA 787 GH10183-PA 215..787 25..603 2768 93.3 Plus
Dgri\GH16452-PA 1676 GH16452-PA 191..628 162..599 922 42.3 Plus
Dgri\GH21475-PA 524 GH21475-PA 58..507 145..594 920 42 Plus
Dgri\GH12950-PA 553 GH12950-PA 99..533 162..590 849 41.2 Plus
Dgri\GH15800-PA 553 GH15800-PA 99..533 162..590 849 41.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-PF 603 CG8049-PF 1..603 1..603 3227 100 Plus
Btk29A-PA 603 CG8049-PA 1..603 1..603 3227 100 Plus
Btk29A-PC 603 CG8049-PC 1..603 1..603 3227 100 Plus
Btk29A-PG 565 CG8049-PG 5..565 43..603 2982 99.5 Plus
Btk29A-PE 786 CG8049-PE 215..786 26..603 2975 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14244-PA 794 GI14244-PA 210..794 25..603 2744 90.9 Plus
Dmoj\GI16710-PA 1591 GI16710-PA 189..626 162..599 924 42.5 Plus
Dmoj\GI19952-PA 523 GI19952-PA 57..506 145..594 917 42 Plus
Dmoj\GI12582-PA 557 GI12582-PA 91..537 145..590 865 41 Plus
Dmoj\GI23933-PA 728 GI23933-PA 343..723 210..594 582 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19386-PA 797 GL19386-PA 218..797 25..603 2704 89.6 Plus
Dper\GL16696-PA 516 GL16696-PA 50..499 145..594 912 41.7 Plus
Dper\GL17941-PA 551 GL17941-PA 38..531 87..590 858 38.9 Plus
Dper\GL21706-PA 734 GL21706-PA 356..729 217..597 601 37.1 Plus
Dper\GL13676-PA 1301 GL13676-PA 935..1283 226..587 547 35.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20789-PA 797 GA20789-PA 217..797 25..603 2825 92.5 Plus
Dpse\GA17894-PA 1713 GA17894-PA 198..630 162..594 922 42.6 Plus
Dpse\GA24271-PA 516 GA24271-PA 50..499 145..594 912 41.7 Plus
Dpse\GA28338-PA 551 GA28338-PA 38..531 87..590 858 38.9 Plus
Dpse\GA30184-PB 736 GA30184-PB 358..731 217..597 601 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13100-PA 785 GM13100-PA 213..785 25..603 2823 96.5 Plus
Dsec\GM24379-PA 1617 GM24379-PA 190..622 162..594 922 42.6 Plus
Dsec\GM16530-PA 517 GM16530-PA 51..500 145..594 911 41.7 Plus
Dsec\Src64B-PA 552 GM13963-PA 68..532 124..590 860 40.5 Plus
Dsec\GM26085-PA 804 GM26085-PA 431..799 222..597 599 37.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22424-PA 621 GD22424-PA 213..599 25..410 1521 83.8 Plus
Dsim\GD10390-PA 517 GD10390-PA 51..500 145..594 911 41.7 Plus
Dsim\Src64B-PA 552 GD13245-PA 68..532 124..590 860 40.5 Plus
Dsim\GD20649-PA 804 GD20649-PA 431..799 222..597 600 37.3 Plus
Dsim\GD20803-PA 1214 GD20803-PA 848..1196 226..587 560 35.7 Plus
Dsim\GD22424-PA 621 GD22424-PA 544..621 526..603 418 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20581-PA 784 GJ20581-PA 208..784 25..603 2759 92.3 Plus
Dvir\GJ12453-PA 1688 GJ12453-PA 209..641 162..594 924 42.6 Plus
Dvir\GJ17854-PA 523 GJ17854-PA 57..506 145..594 917 42 Plus
Dvir\GJ15487-PA 554 GJ15487-PA 36..534 77..590 866 37.8 Plus
Dvir\GJ10294-PA 739 GJ10294-PA 354..734 210..594 589 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23856-PA 786 GK23856-PA 211..786 25..603 2799 94 Plus
Dwil\GK21551-PA 518 GK21551-PA 52..501 145..594 910 42.1 Plus
Dwil\GK17605-PA 552 GK17605-PA 26..532 65..590 868 38.2 Plus
Dwil\GK20085-PA 1714 GK20085-PA 209..605 162..594 736 37.2 Plus
Dwil\GK14320-PA 730 GK14320-PA 352..727 217..599 589 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11074-PA 782 GE11074-PA 210..782 25..603 2822 96.5 Plus
Dyak\GE22200-PA 1616 GE22200-PA 189..621 162..594 923 42.6 Plus
Dyak\GE20659-PA 517 GE20659-PA 51..500 145..594 910 41.7 Plus
Dyak\GE20600-PA 552 GE20600-PA 68..532 124..590 861 40.5 Plus
Dyak\GE10101-PA 724 GE10101-PA 351..719 222..597 599 37.3 Plus

LD18251.hyp Sequence

Translation from 2278 to 4089

> LD18251.hyp
MIPCVSLAETSVIGNMKERVKEMKVFGCRLNFWNHIGHSLTSSKTKEGNG
SSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGG
GGGGGGSCTPTSLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTP
NSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVK
DALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCF
VVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPD
LINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELG
SGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQ
LYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSK
GMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGT
KFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVV
ERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQT
LTD*

LD18251.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-PF 603 CG8049-PF 1..603 1..603 3227 100 Plus
Btk29A-PA 603 CG8049-PA 1..603 1..603 3227 100 Plus
Btk29A-PC 603 CG8049-PC 1..603 1..603 3227 100 Plus
Btk29A-PG 565 CG8049-PG 5..565 43..603 2982 99.5 Plus
Btk29A-PE 786 CG8049-PE 215..786 26..603 2975 96.7 Plus