Clone LD18758 Report

Search the DGRC for LD18758

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:187
Well:58
Vector:pBS SK-
Associated Gene/TranscriptRYBP-RA
Protein status:LD18758.pep: gold
Preliminary Size:2183
Sequenced Size:2074

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12190 2001-01-01 Release 2 assignment
CG12190 2001-11-29 Blastp of sequenced clone
CG12190 2003-01-01 Sim4 clustering to Release 3
CG12190 2008-04-29 Release 5.5 accounting
CG12190 2008-08-15 Release 5.9 accounting
CG12190 2008-12-18 5.12 accounting

Clone Sequence Records

LD18758.complete Sequence

2074 bp (2074 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069460

> LD18758.complete
TTGCCGCAGCCAAAAAGACAATTGCAGAAAGTTTTTTTCACAACAAAAAG
CCACCGAAAACGCTCCAATTAAGCAACAAATGCGTGCCAAAAGCGCAGCG
AATCTCCACTGAGGCCACCGTGTGTGCGTGAGCGTGGCAAAGGTGCGAGC
AGAGCAACCAAACATCACAGGAACACGGCCAGCAGCAGCAGCGGATCAGC
AGAGGGGCGGGCAGAGGCAGAGGCGGTGGCAGAGGGAAAAGTCGGGCATT
TTCATTGGATTCGTTTTGGTCCGATTCGATTGGATTGCGGTTACTCCAGC
GGCGCCCAGGCGTTCCTCCTCTCCTCCTGTATTATGGACAAGAAATCCTC
GCCGGTGCGACGACAAAAGCGGCAGGCGAAGGTGATCGAGGAGAACTTCT
GGGACTGCAGCGTCTGCACATATAGAAACTCGGCGGAGGCCTTCAAGTGT
CGCATGTGCGACGTGCGGAAAGGAACCTCCACGCGAAAGCCACGCCTGAA
CTCAGCGCTAGTCGCCCAGCAGGCCGCCACTTTGCCAGGAGCCAGTGTCA
ACATGCCCAACGGGAAGTCCGCCTCCGGATCACGGCATGGCAGTGGGCAC
GACCGGCAGAGGCACAAGCGGTATCCGGCACGGTTGAAAAACGTGGACCG
ATCGACGGCACAGACGCGAGAGGTGACGGTCAACTCGGTGACCGTGTTCA
TCACAGAGTACAAGGCCAAGCCGGTGAGCAGCCGACGCGAATCCAGTGAG
CAGAGCTTCAGCGAGAGCAACGACAGCCGGAGTTAGAGGAGGGATACAAG
GCCTCCTCGCCCCCAGCTCCCCAATATTCTACGCCACGGTTCCCGCTCCC
CTGTTACAAGTTGTAAATTCTAAGTGTTAGGCCCCTGGCGATAACAATTG
TAAATCGAAATCCATTTAAGTTACCAAGTATTAGGCCACGTTTAAAGCCC
CGAAAGCCAAGCCCCCACTAGTTCATGACTTCCAGCCCAGGCCAAGATGG
CAAAGCAAAGCGAAGCGACGGCGAGTCGATTGCATTTACACGACGCTCTC
CAAATCCCATTTTAAAATGCGCTAGACCCTGTAAATAGCGATGCATGAGT
TCCCTGAATATCTCTGTCTCGTATCGTAATTTTAGTTGTAATTTAATTCT
GCTACTCTAATTCCTAATTTATTGATGCAAAGGTAACTATGTATAACCGC
CGTGTACATGTTCAACAAAGATATCATTTGTTTTGTAAGTGTCGAATTAA
AATATGGTTTAACTAAGTGCAAGTTAATCTCAATGTTCCACTAGCAGCGC
CCATCCCCCATGGTTTGTGTAACTATTATAAACTGCCCTTTTTTTTTTGA
CTAGAAAATGCTGCTTGACAACGAAGTGTAGCGAGAAGAGAGCCACGTAG
CTTGGTTGTAGACAATTTGCTAATTTTAATTTGTTTGTATACAAGACTGA
TTAAGCGTTACCAACCAGATATAGAGAGGTCCGCACACGCACCCAGCCCG
AATCCGATTTTCCTTTTGGTTTACACCCGAGATAGCCTCACAGCCAGCAA
ACAATAGACGAATACTCGAACTCGCAAAAAGAGAATTTTGTACTTAGCAG
AGCTTAAACGCTCTTCCACCATAGCAATAATTACTTAGCAAACAATGAAA
AACATGAATTTTGATATGAACGATTGTATTTAATATTGGATAACAGATAT
AATGGTTTATAAAGTGCTTGATATTTGTATTTTGAGATAGATTATTTAGC
CACACATGAACACTAACACACACCCACTCGAAACTGCCGACTGTAGTCAA
GAAACAACTTCCAATAGACAAACTTCAATTTGGATTATCGTAAACATGTA
CAATTAATATGAACAGTTTGTATTCCAAATGCTTGGCCAGTTGAGCATTA
ATCAACAGCAACGACAAAGACAAAGACAAAACTTAAGCAAACGCAATTAA
AGCCGCACTCACACGACAACACGGATAGTTAAAACTTGAATTCCAATTGT
AAAGCGTAAACTTTTAAAGCATTATAAAATACATTAAATAAATTTCGAAA
ATGCTAAAAAAAAAAAAAAAAAAA

LD18758.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RA 2234 RYBP-RA 115..2170 1..2056 10280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18558165..18559749 471..2055 7755 99.6 Plus
chr2R 21145070 chr2R 18557311..18557783 1..473 2365 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 453 CG12190-PB 1..453 334..786 2265 100 Plus
RYBP-RA 453 CG12190-PA 1..453 334..786 2265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 2242 CG12190-RB 188..2242 1..2055 10275 100 Plus
RYBP-RA 2064 CG12190-RA 10..2064 1..2055 10275 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-PB 150 CG12190-PB 1..131 334..726 682 100 Plus
RYBP-PA 150 CG12190-PA 1..131 334..726 682 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22671628..22673213 471..2056 7930 100 Plus
2R 25286936 2R 22670774..22671246 1..473 2365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22672827..22674412 471..2056 7930 100 Plus
2R 25260384 2R 22671973..22672445 1..473 2365 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:41:11 has no hits.

LD18758.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:30:36 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18558167..18559749 473..2055 99   Plus
chr2R 18557311..18557782 1..472 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:19 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 1..453 334..786 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:23:41 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 1..453 334..786 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:43:21 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 1..453 334..786 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:21 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 1..453 334..786 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:36 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 1..453 334..786 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:58:57 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 23..2077 1..2055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:23:41 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 23..2077 1..2055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:43:21 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 28..2082 1..2055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:22 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 23..2077 1..2055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:36 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 10..2064 1..2055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:30:36 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22671630..22673212 473..2055 100   Plus
2R 22670774..22671245 1..472 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:43:21 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18559135..18560717 473..2055 100   Plus
arm_2R 18558279..18558750 1..472 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:26:46 Download gff for LD18758.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22672829..22674411 473..2055 100   Plus
2R 22671973..22672444 1..472 100 -> Plus

LD18758.pep Sequence

Translation from 333 to 785

> LD18758.pep
MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTST
RKPRLNSALVAQQAATLPGASVNMPNGKSASGSRHGSGHDRQRHKRYPAR
LKNVDRSTAQTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSRS
*

LD18758.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 03:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11639-PA 150 GF11639-PA 1..150 1..150 784 99.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 03:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22783-PA 150 GG22783-PA 1..150 1..150 788 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 03:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19772-PA 151 GH19772-PA 1..151 1..150 681 96.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 03:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-PB 150 CG12190-PB 1..150 1..150 771 100 Plus
RYBP-PA 150 CG12190-PA 1..150 1..150 771 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 03:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20311-PA 150 GI20311-PA 1..150 1..150 772 98 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 03:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11369-PA 150 GL11369-PA 1..150 1..150 774 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 03:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11466-PA 150 GA11466-PA 1..150 1..150 774 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 03:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15940-PA 150 GM15940-PA 1..150 1..150 788 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 03:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11693-PA 150 GD11693-PA 1..150 1..150 788 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 03:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22038-PA 150 GJ22038-PA 1..150 1..150 772 98 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 03:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21447-PA 151 GK21447-PA 1..151 1..150 666 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 03:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14012-PA 150 GE14012-PA 1..150 1..150 788 99.3 Plus

LD18758.hyp Sequence

Translation from 333 to 785

> LD18758.hyp
MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTST
RKPRLNSALVAQQAATLPGASVNMPNGKSASGSRHGSGHDRQRHKRYPAR
LKNVDRSTAQTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSRS
*

LD18758.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-PB 150 CG12190-PB 1..150 1..150 771 100 Plus
RYBP-PA 150 CG12190-PA 1..150 1..150 771 100 Plus