Clone LD18931 Report

Search the DGRC for LD18931

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:189
Well:31
Vector:pBS SK-
Associated Gene/TranscriptRpn6-RB
Protein status:LD18931.pep: gold
Preliminary Size:2771
Sequenced Size:1816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10149 2000-02-14 Blastp of sequenced clone
CG10145 2001-01-01 Release 2 assignment
CG10149 2001-01-01 Release 2 assignment
CG12858 2001-01-01 Release 2 assignment
CG10149 2003-01-01 Sim4 clustering to Release 3
Rpn6 2008-04-29 Release 5.5 accounting
Rpn6 2008-08-15 Release 5.9 accounting
Rpn6 2008-12-18 5.12 accounting

Clone Sequence Records

LD18931.complete Sequence

1816 bp (1816 high quality bases) assembled on 2000-02-14

GenBank Submission: AF160939

> LD18931.complete
CAACGACCGAAAGGTGAAAAAGTCAGCATTAAACACGTAAATACGCAATC
AATACACACCGGAAACGATCGAACACAAAGAAAAAATTGTCGCATTGCTA
GTAGCTGAGTTGAGACAAGCTTAGTTGATTGATTGATTAGTAAATTTTTG
AGTTGAGCGCCCCCACATCTCATCTCGTCTCGTCCGAACACAAATTTCAA
GTCGCAAGATGGCCGGAGCAACACTTTTCGAGCGTGCCCAGGCATTGTCC
AGCGTGAATCGCGAGGAGCAGGATAGTTCGCTGCTGAACAAACTGGTCCG
CGACCAGGAGGGCGCCGAGAACGATGAGGAGCGCATCCGAATCAAGGAGC
AGGGCATTCTGCAGCAGGGCGAGCTCTACAAGCAGGAGGGCAAGGCCAAG
GAGCTGGCCGATCTCATCAAGGTGACGCGTCCGTTCCTCAGCTCGATCAG
CAAGGCCAAGGCGGCCAAGCTGGTGCGTTCGCTGGTGGACATGTTCCTGG
ACATGGACGCGGGCACAGGCATTGAGGTTCAATTGTGTAAAGACTGCATT
GAGTGGGCCAAACAGGAGAAGCGCACATTTCTTCGCCAATCGCTGGAAGC
TCGTCTGATTGCCTTATATTTTGATACTGCTTTGTACACGGAGGCCTTGG
CTCTGGGTGCCCAATTGCTGCGCGAGCTGAAAAAGCTGGATGACAAGAAT
CTGCTGGTGGAAGTGCAGCTGCTGGAGAGCAAAACCTATCACGCACTGAG
CAACCTGCCCAAGGCTAGGGCCGCCCTCACCTCAGCCCGCACCACGGCCA
ATGCTATCTACTGTCCGCCAAAGGTGCAAGGCGCACTGGATCTTCAGTCC
GGCATCCTACATGCGGCTGATGAGCGTGACTTTAAGACCGCATTCTCCTA
TTTCTACGAGGCCTTTGAAGGATTCGACAGCGTGGACAGCGTCAAGGCCT
TGACCTCGCTTAAATACATGTTGCTGTGCAAAATCATGTTGGGACAGTCC
GATGATGTCAACCAGCTCGTCAGTGGAAAGCTGGCTATTACCTATTCGGG
CCGCGATATAGATGCTATGAAATCAGTGGCTGAGGCTTCACACAAACGTT
CCCTGGCCGACTTCCAGGCTGCCCTCAAGGAATACAAAAAGGAGCTCGCC
GAGGATGTGATTGTGCAGGCGCATTTGGGCACGTTATACGACACCATGTT
GGAGCAAAACTTGTGCCGCATCATTGAACCCTACTCTCGTGTGCAGGTCG
CCCATGTTGCCGAGAGCATTCAGCTGCCCATGCCGCAGGTGGAAAAGAAG
CTGTCCCAAATGATCCTGGACAAAAAGTTCAGCGGCATTCTGGATCAGGG
TGAGGGAGTACTGATTGTTTTCGAAGAGACGCCCGTGGACAAGACCTATG
AACGCGTGCTGGAAACCATACAAAGTATGGGTAAGGTGGTGGACACACTG
TACCAGAAGGCTAAGAAGCTGTCGTAAGCGGTGTGCAGGAGACATTATTC
AACTCAAACATGATATCAGCATACTTAGCAGACTTTTCATAGTTTCCTTT
TGTATTTTCCAACAACTCCCAAGCATTGTTCAAGCCAAACATGTTTTATG
TTTCTGCAAAAGCAAAATGAATTGGTGAAGATAGCAACAGGAGCAGCAAC
AACCACAAAAAAATGTAAAACAAAATCCATTAAACTAACATAAGCAAAAT
TATTAATCATTGAGTGGGATCGAATTGTTTACGCAAGTGCGGTATAATAA
GCAAAATATTCAAATAACTACAAAATAAAATGATAAAAGAAAACCGTAAA
AAAAAAAAAAAAAAAA

LD18931.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RB 1991 Rpn6-RB 119..1918 1..1800 9000 100 Plus
Rpn6-RA 1729 Rpn6-RA 118..1717 201..1800 8000 100 Plus
Rpn6.a 1680 Rpn6.a 70..1668 202..1800 7995 100 Plus
Rpn6.a 1680 Rpn6.a 34..69 1..36 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10637452..10638006 1797..1243 2775 100 Minus
chr2R 21145070 chr2R 10639000..10639527 528..1 2625 99.8 Minus
chr2R 21145070 chr2R 10638430..10638939 1034..525 2550 100 Minus
chr2R 21145070 chr2R 10638067..10638282 1248..1033 1080 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RA 1320 CG10149-PA 44..1320 201..1477 6385 100 Plus
Rpn6-RC 1269 CG10149-PC 1..1269 209..1477 6345 100 Plus
Rpn6-RB 1269 CG10149-PB 1..1269 209..1477 6345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RB 1827 CG10149-RB 31..1827 1..1797 8985 100 Plus
Rpn6-RC 1662 CG10149-RC 67..1662 202..1797 7980 100 Plus
Rpn6-RA 1612 CG10149-RA 118..1612 201..1695 7475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-PA 439 CG10149-PA 16..439 203..1474 2019 100 Plus
Rpn6-PC 422 CG10149-PC 1..422 209..1474 2009 100 Plus
Rpn6-PB 422 CG10149-PB 1..422 209..1474 2009 100 Plus
alien-PD 444 CG9556-PD 41..410 251..1363 217 22.3 Plus
alien-PE 444 CG9556-PE 41..410 251..1363 217 22.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14750163..14750720 1800..1243 2790 100 Minus
2R 25286936 2R 14751714..14752241 528..1 2640 100 Minus
2R 25286936 2R 14751144..14751653 1034..525 2550 100 Minus
2R 25286936 2R 14750781..14750996 1248..1033 1080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14751362..14751919 1800..1243 2790 100 Minus
2R 25260384 2R 14752913..14753440 528..1 2640 100 Minus
2R 25260384 2R 14752343..14752852 1034..525 2550 100 Minus
2R 25260384 2R 14751980..14752195 1248..1033 1080 100 Minus
Blast to na_te.dros performed 2014-11-27 07:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2375..2470 1603..1699 140 61.9 Plus
roo 9092 roo DM_ROO 9092bp 1131..1290 1633..1790 128 59.4 Plus

LD18931.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:43:11 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10639002..10639527 1..526 99   Minus
chr2R 10638431..10638937 527..1033 100 <- Minus
chr2R 10638069..10638281 1034..1246 100 <- Minus
chr2R 10637452..10638002 1247..1797 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:29 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 44..1320 201..1477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:36:11 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 44..1320 201..1477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:18 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 44..1320 201..1477 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:12:06 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 44..1320 201..1477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:11 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 44..1320 201..1477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:39:25 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 78..1874 1..1797 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:36:10 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 78..1874 1..1797 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:18 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 31..1827 1..1797 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:12:06 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 78..1874 1..1797 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:11 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 31..1827 1..1797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:43:11 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14751716..14752241 1..526 100   Minus
2R 14751145..14751651 527..1033 100 <- Minus
2R 14750783..14750995 1034..1246 100 <- Minus
2R 14750166..14750716 1247..1797 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:18 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10639221..10639746 1..526 100   Minus
arm_2R 10638650..10639156 527..1033 100 <- Minus
arm_2R 10638288..10638500 1034..1246 100 <- Minus
arm_2R 10637671..10638221 1247..1797 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:48:35 Download gff for LD18931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752915..14753440 1..526 100   Minus
2R 14752344..14752850 527..1033 100 <- Minus
2R 14751982..14752194 1034..1246 100 <- Minus
2R 14751365..14751915 1247..1797 100 <- Minus

LD18931.pep Sequence

Translation from 208 to 1476

> LD18931.pep
MAGATLFERAQALSSVNREEQDSSLLNKLVRDQEGAENDEERIRIKEQGI
LQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMD
AGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALG
AQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTS
LKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLA
DFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHV
AESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERV
LETIQSMGKVVDTLYQKAKKLS*

LD18931.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13517-PA 422 GF13517-PA 1..422 1..422 2182 97.9 Plus
Dana\GF22104-PA 444 GF22104-PA 102..410 78..385 212 22.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22404-PA 439 GG22404-PA 18..439 1..422 2199 99.1 Plus
Dere\GG24040-PA 444 GG24040-PA 102..410 78..385 212 22.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21149-PA 421 GH21149-PA 1..421 1..422 2103 95.5 Plus
Dgri\GH25117-PA 444 GH25117-PA 102..410 78..385 208 22.3 Plus
Dgri\GH22257-PA 444 GH22257-PA 102..410 78..385 208 22.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-PC 422 CG10149-PC 1..422 1..422 2086 100 Plus
Rpn6-PB 422 CG10149-PB 1..422 1..422 2086 100 Plus
Rpn6-PA 439 CG10149-PA 18..439 1..422 2086 100 Plus
alien-PD 444 CG9556-PD 41..410 15..385 233 22.3 Plus
alien-PE 444 CG9556-PE 41..410 15..385 233 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18748-PA 421 GI18748-PA 1..421 1..422 2108 95.3 Plus
Dmoj\GI11968-PA 444 GI11968-PA 102..410 78..385 205 22.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10628-PA 421 GL10628-PA 1..421 1..422 2136 96.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24424-PA 421 GA24424-PA 1..421 1..422 2136 96.7 Plus
Dpse\GA21877-PA 444 GA21877-PA 102..410 78..385 209 22.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20190-PA 439 GM20190-PA 18..439 1..422 2216 99.8 Plus
Dsec\GM12583-PA 444 GM12583-PA 102..410 78..385 212 22.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25662-PA 328 GD25662-PA 1..328 95..422 1733 99.7 Plus
Dsim\GD22368-PA 444 GD22368-PA 102..410 78..385 212 22.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21772-PA 421 GJ21772-PA 1..421 1..422 2105 95.5 Plus
Dvir\GJ14108-PA 444 GJ14108-PA 102..410 78..385 207 22.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19517-PA 425 GK19517-PA 1..425 1..422 2145 95.8 Plus
Dwil\GK23707-PA 444 GK23707-PA 102..410 78..385 214 22.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12293-PA 439 GE12293-PA 18..439 1..422 2203 99.1 Plus
Dyak\GE10643-PA 444 GE10643-PA 102..410 78..385 212 22.3 Plus

LD18931.hyp Sequence

Translation from 208 to 1476

> LD18931.hyp
MAGATLFERAQALSSVNREEQDSSLLNKLVRDQEGAENDEERIRIKEQGI
LQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMD
AGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALG
AQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTS
LKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLA
DFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHV
AESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERV
LETIQSMGKVVDTLYQKAKKLS*

LD18931.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-PC 422 CG10149-PC 1..422 1..422 2086 100 Plus
Rpn6-PB 422 CG10149-PB 1..422 1..422 2086 100 Plus
Rpn6-PA 439 CG10149-PA 18..439 1..422 2086 100 Plus
alien-PD 444 CG9556-PD 41..410 15..385 233 22.3 Plus
alien-PE 444 CG9556-PE 41..410 15..385 233 22.3 Plus