Clone LD20229 Report

Search the DGRC for LD20229

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:202
Well:29
Vector:pBS SK-
Associated Gene/Transcriptmael-RA
Protein status:LD20229.pep: gold
Preliminary Size:1956
Sequenced Size:1862

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11254 2001-01-01 Release 2 assignment
CG11254 2002-06-06 Blastp of sequenced clone
CG11254 2003-01-01 Sim4 clustering to Release 3
mael 2008-04-29 Release 5.5 accounting
mael 2008-08-15 Release 5.9 accounting
mael 2008-12-18 5.12 accounting

Clone Sequence Records

LD20229.complete Sequence

1862 bp (1862 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119598

> LD20229.complete
AAACAGTCAATAATAGATATTTGAAGTGTCAGCGGAATCGACGTCTGACA
AAACAACTGCTTCACTTCATTAGAATTGTGTGATATATTCCACAGACCAG
ATCATTGGAAGAGAAGTCAATCGTGCGTGAGAGAAGCCAGAAGAGAAGCC
ACCCGCGACATTCCGAAGTAACCATTTCTGTAGGGTCAGACGTACATACA
AACAACATTCATATAAATTGCTCGTGCTGTTCATTGGTTACCGCCTTTAG
TCGCTACCTCGCTCGCACACGCGCTCAACACCTACCCTTACCCGTCAAAA
ATACCGACCTTCTTCTTGCCACGCCCGTAAAGATGGCTCCTAAGAAGCAT
AGTGGGTTTATGATGTTCGTAAACGAGTGGAGAAACCGGAACGCCGAGGG
CCGACGCATGACGCTGGCGCAGGCTGTTTCCCACTGCGGCACCATATGGG
AGAAAATGAACACCCAGCAGCGTGGTCCGTACAACTCAGGCGGCAAGGAC
GCAAATGTGGCGCAACGCGCCAAAAGGGAAAGTTCCAACGGCCACGGCCA
GGTGGACAAGGCCCAAAGGGAGGCCACCGAGAGCTTGATGGACATGAAAC
GTACCATCGAGCGCCTCGTGCTAAACGCCAAGATGTCCCATGATCTGGAG
AATGCCAAGTTTGTCTTCGTTGCCTTCAACTACTTCACTAAAGCCTTGAC
CACCGACGTCTATGTGCCCGCCGAGTTTGCGGCATGCGAATATTCGTTGA
AGGAGGGAATCCGATCCATCTACAGCACCATGATTGACCCCGGTCAGATC
ATTTTTGGGCAAGGTAGCGATGCCCTGCTTCACTCTTCAACCACTCACGA
CCTGCCGCTGCCGCCCAACGCGCTGGGGGAGAAGAACATGACCAAGCTGT
ACCGCAACATTGTTGACTACTTATCCAAATGCCAGGGAAAAGGCAAGACC
CTAGTAGTCTTTACACCCGCCGAAAATATTACCATGGTGAAGTCATGCTT
CCGCTATTTGGAGTGCGATGATGACTTCAGGGACGGGGGCGAAAAAATCC
AGGTGTTTGATATCCAGTACTTGCTATTCATATTGAAGAAGGAGGTCATG
AATGTCGCTGATTTGAATGACGAGAAAATCAACAAATTCGCGACGGATGC
TTTTTTTAAGAAAGACTTTTTCGAGTTTACCGCAGGGATTGCGTGTCAGT
ACCACGAGGATAATGATCGAACCAAGTACTGTACCCAGAGTATGGTGACT
AGATGGGCGTATACCTTCACTGATTTTATGTGCGGAGACCTGGCCATAAC
CGTCCAACCCGGAAAGCACATACCTGCCCAAACAAAACCCAACTACCTTA
TCATAAGCTCGTACGCCTCCTCACTCGACCACGAGTCCTCCTTCGACTCT
TTTTATTCGCTTCCCGGATCTGGGGTCAAGAAGGAAAGCCAACCCGAAGC
TTGTTCGCTTTCTAGCAGTCGACTTTCCGTCGCATCAAGCTCCTACAAGC
CCATAGACCACACTTCCTTTGCCGCAAATTTAAACGAAGTTTCTGAATTC
CCCAGCCTCGGCATGCGTAATTCTAGTAAGCATCACGGTATCGCCGCTAG
TGCTCAGCGGGAATGGAACGCTAGGAACTTACCGACGCACTCGCGTTTAA
TTCGGAAGGTTTCAGACAACGACTTCTCCGTAAACGGCGCTGATGGGAAA
CTTAAAAAATAAGCCACTTTGGTCTATCAATTGGACTAAGAAACAATGAT
TCCTTATAGATAATTTTCTTATCGCATTAAACTGTACAAATACTATTACT
TGTATTTAAAAATAAATTCGTTCAAACGGAAAAAAAATAAAAAAAAAAAA
AAAAAAAAAAAA

LD20229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RB 1878 mael-RB 46..1875 1..1830 9150 100 Plus
mael.d 1940 mael.d 111..1940 1..1830 9150 100 Plus
mael-RC 1839 mael-RC 460..1839 451..1830 6900 100 Plus
mael-RC 1839 mael-RC 1..452 1..452 2260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22714505..22715138 1197..1830 3170 100 Plus
chr3L 24539361 chr3L 22713888..22714445 642..1199 2790 100 Plus
chr3L 24539361 chr3L 22713137..22713588 1..452 2260 100 Plus
chr3L 24539361 chr3L 22713641..22713832 451..642 960 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 1380 CG11254-PD 1..1380 333..1712 6900 100 Plus
mael-RB 1380 CG11254-PB 1..1380 333..1712 6900 100 Plus
mael-RA 1380 CG11254-PA 1..1380 333..1712 6900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:07:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 2143 CG11254-RD 315..2143 1..1829 9145 100 Plus
mael-RB 1830 CG11254-RB 2..1830 1..1829 9145 100 Plus
mael-RC 1839 CG11254-RC 2..1839 1..1829 9020 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
mael-PD 459 CG11254-PD 1..459 333..1709 2236 100 Plus
mael-PB 459 CG11254-PB 1..459 333..1709 2236 100 Plus
mael-PA 459 CG11254-PA 1..459 333..1709 2236 100 Plus
mael-PC 462 CG11254-PC 1..462 333..1709 2222 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22725602..22726235 1197..1830 3170 100 Plus
3L 28110227 3L 22724985..22725542 642..1199 2790 100 Plus
3L 28110227 3L 22724234..22724685 1..452 2260 100 Plus
3L 28110227 3L 22724738..22724929 451..642 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22718702..22719335 1197..1830 3170 100 Plus
3L 28103327 3L 22718085..22718642 642..1199 2790 100 Plus
3L 28103327 3L 22717334..22717785 1..452 2260 100 Plus
3L 28103327 3L 22717838..22718029 451..642 960 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:58:58 has no hits.

LD20229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:21:03 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22714508..22715138 1200..1830 100   Plus
chr3L 22713889..22714445 643..1199 100 -> Plus
chr3L 22713643..22713832 453..642 100 -> Plus
chr3L 22713137..22713588 1..452 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:54:34 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1380 333..1712 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:30:35 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1380 333..1712 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:55 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RA 1..1380 333..1712 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:20:44 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1380 333..1712 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:03 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RA 1..1380 333..1712 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:00:21 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1830 1..1830 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:30:35 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1829 1..1829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:55 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 2..1830 1..1829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:20:44 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1830 1..1830 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:03 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 2..1830 1..1829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:21:03 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22725605..22726235 1200..1830 100   Plus
3L 22724986..22725542 643..1199 100 -> Plus
3L 22724740..22724929 453..642 100 -> Plus
3L 22724234..22724685 1..452 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:55 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22718705..22719335 1200..1830 100   Plus
arm_3L 22718086..22718642 643..1199 100 -> Plus
arm_3L 22717840..22718029 453..642 100 -> Plus
arm_3L 22717334..22717785 1..452 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:54:29 Download gff for LD20229.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22718705..22719335 1200..1830 100   Plus
3L 22718086..22718642 643..1199 100 -> Plus
3L 22717840..22718029 453..642 100 -> Plus
3L 22717334..22717785 1..452 100 -> Plus

LD20229.pep Sequence

Translation from 332 to 1711

> LD20229.pep
MAPKKHSGFMMFVNEWRNRNAEGRRMTLAQAVSHCGTIWEKMNTQQRGPY
NSGGKDANVAQRAKRESSNGHGQVDKAQREATESLMDMKRTIERLVLNAK
MSHDLENAKFVFVAFNYFTKALTTDVYVPAEFAACEYSLKEGIRSIYSTM
IDPGQIIFGQGSDALLHSSTTHDLPLPPNALGEKNMTKLYRNIVDYLSKC
QGKGKTLVVFTPAENITMVKSCFRYLECDDDFRDGGEKIQVFDIQYLLFI
LKKEVMNVADLNDEKINKFATDAFFKKDFFEFTAGIACQYHEDNDRTKYC
TQSMVTRWAYTFTDFMCGDLAITVQPGKHIPAQTKPNYLIISSYASSLDH
ESSFDSFYSLPGSGVKKESQPEACSLSSSRLSVASSSYKPIDHTSFAANL
NEVSEFPSLGMRNSSKHHGIAASAQREWNARNLPTHSRLIRKVSDNDFSV
NGADGKLKK*

LD20229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20523-PA 468 GF20523-PA 1..420 1..413 1463 67.1 Plus
Dana\GF10993-PA 424 GF10993-PA 1..398 1..408 1322 61.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16274-PA 465 GG16274-PA 1..464 1..458 2001 82.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14807-PA 429 GH14807-PA 1..423 1..445 1126 51.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
mael-PD 459 CG11254-PD 1..459 1..459 2409 100 Plus
mael-PB 459 CG11254-PB 1..459 1..459 2409 100 Plus
mael-PA 459 CG11254-PA 1..459 1..459 2409 100 Plus
mael-PC 462 CG11254-PC 1..462 1..459 2395 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11511-PA 454 GI11511-PA 1..435 1..430 1083 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13552-PA 397 GL13552-PA 1..377 42..412 950 51.5 Plus
Dper\GL13550-PA 397 GL13550-PA 1..377 42..412 948 51.5 Plus
Dper\GL11741-PA 250 GL11741-PA 11..162 73..229 393 51.9 Plus
Dper\GL18103-PA 219 GL18103-PA 1..146 1..142 310 46.9 Plus
Dper\GL16627-PA 127 GL16627-PA 1..107 304..412 227 47.7 Plus
Dper\GL18103-PA 219 GL18103-PA 148..217 290..359 192 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26892-PB 438 GA26892-PB 1..418 1..412 1052 50.7 Plus
Dpse\GA28467-PA 371 GA28467-PA 1..369 1..359 918 49.1 Plus
Dpse\GA28156-PA 370 GA28156-PA 1..368 1..359 913 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22468-PA 394 GM22468-PA 1..308 1..296 1386 84.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15049-PA 394 GD15049-PA 1..308 1..296 1398 84.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13702-PA 444 GJ13702-PA 1..425 1..430 1228 53.7 Plus
Dvir\GJ11659-PA 413 GJ11659-PA 5..306 4..331 404 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16773-PA 486 GK16773-PA 1..387 1..360 1030 51.3 Plus
Dwil\GK13134-PA 257 GK13134-PA 1..247 95..331 616 48.6 Plus
Dwil\GK16772-PA 847 GK16772-PA 36..274 83..331 524 39.4 Plus
Dwil\GK14155-PA 208 GK14155-PA 2..199 145..332 511 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mael-PA 505 GE22634-PA 41..504 1..458 1985 80.8 Plus

LD20229.hyp Sequence

Translation from 332 to 1711

> LD20229.hyp
MAPKKHSGFMMFVNEWRNRNAEGRRMTLAQAVSHCGTIWEKMNTQQRGPY
NSGGKDANVAQRAKRESSNGHGQVDKAQREATESLMDMKRTIERLVLNAK
MSHDLENAKFVFVAFNYFTKALTTDVYVPAEFAACEYSLKEGIRSIYSTM
IDPGQIIFGQGSDALLHSSTTHDLPLPPNALGEKNMTKLYRNIVDYLSKC
QGKGKTLVVFTPAENITMVKSCFRYLECDDDFRDGGEKIQVFDIQYLLFI
LKKEVMNVADLNDEKINKFATDAFFKKDFFEFTAGIACQYHEDNDRTKYC
TQSMVTRWAYTFTDFMCGDLAITVQPGKHIPAQTKPNYLIISSYASSLDH
ESSFDSFYSLPGSGVKKESQPEACSLSSSRLSVASSSYKPIDHTSFAANL
NEVSEFPSLGMRNSSKHHGIAASAQREWNARNLPTHSRLIRKVSDNDFSV
NGADGKLKK*

LD20229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
mael-PD 459 CG11254-PD 1..459 1..459 2409 100 Plus
mael-PB 459 CG11254-PB 1..459 1..459 2409 100 Plus
mael-PA 459 CG11254-PA 1..459 1..459 2409 100 Plus
mael-PC 462 CG11254-PC 1..462 1..459 2395 99.4 Plus