Clone LD21311 Report

Search the DGRC for LD21311

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:213
Well:11
Vector:pOT2
Associated Gene/Transcriptyki-RD
Protein status:LD21311.pep: gold
Preliminary Size:2200
Sequenced Size:1275

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4005 2001-01-01 Release 2 assignment
CG4005 2001-09-19 Blastp of sequenced clone
CG4005 2003-01-01 Sim4 clustering to Release 3
yki 2008-04-29 Release 5.5 accounting
yki 2008-08-15 Release 5.9 accounting
yki 2008-12-18 5.12 accounting

Clone Sequence Records

LD21311.complete Sequence

1275 bp (1275 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058506

> LD21311.complete
AACACCTTAATGTTATAGTTTCGCGCAGCGCGATGGAGTGATACGTATAT
GGAAGAACATATATGTGCGCGTGCCTAATCGCTAAGATAATTCTATGTAG
TTTTCGTTTGTATACAATAAGTGCCTTTTATATGTTAACGACGATGTCAG
CCAGCAGCAATACAAACAGCCTGATCGAGAAGGAGATCGACGACGAGGAC
ATGCTTTCGCCGATCAAGTCCAACAACCTGGTGGTGCGGGTCAACCAGGA
CACGGACGACAACCTGCAGGCGCTATTCGACAGCGTCCTGAATCCGGGTG
ACGCCAAGCGCCCGCTGCAGCTGCCCCTGCGCATGCGGAAGCTGCCCAAC
TCCTTCTTCACGCCCCCGGCGCCCTCGCACTCGCGGGCCAACAGCGCCGA
CTCCACCTACGACGCGGGCTCCCAGTCGAGCATCAACATCGGGAACAAGG
CGTCCATCGTCCAGCAGCCAGATGGCCAGTCGCCCATCGCCGCCATCCCC
CAGCTCCAGATTCAGCCGTCTCCCCAGCACAGCCGCCTGGCGATACATCA
CTCCCGAGCCCGCAGCAGCCCCGCCTCGCTGCAGCAGAACTACAATGTGC
GCGCCCGGAGCGACGCAGCAGCAGCCAACAATCCGAATGCCAATCCGAGC
AGCCAACAGCAGCCCGCTGGGCCCACTTTCCCAGAGAACAGTGCCCAAGA
GTTCCCCAGCGGCGCCCCGGCCAGCTCGGCCATTGATCTGGACGCCATGA
ACACCTGCATGTCGCAGGACATTCCCATGTCCATGCAGACAGTGCACAAG
AAGCAGCGCTCCTACGACGTCATCAGCCCCATTCAGTTGAACCGCCAACT
AGGCGCCTTGCCGCCGGGATGGGAGCAAGCCAAGACCAATGATGGCCAGA
TCTACTACTTGAATCATACTACAAAATCTACGCAGTGGGAGGATCCCAGA
ATCCAATATCGCCAGCAGCAGCAAATCTTGATGGCCGAGCGAATAAAGCA
GAATGAATCTGGGCTTAGCGTGCTCGACTGCCCAGATAACTTAGTGTCTT
CCCTCCAGATTGAGGATAATCTTTGCAGTAACTTGTTCAATGACGCACAG
GCCATTGTAAATCCGCCGTCTTCCCACAAACCTGACGATTTGGAATGGTA
TAAAATTAATTAATTCAATGTATACATCTGTATTAGACCTAAAAGTTTTA
TATTTTGTATTATTCTAAATTAAATATTTTTCAAATTTTATAGTATTTCT
TTACATAAAAAAAAAAAAAAAAAAA

LD21311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1523 yki-RD 183..1441 1..1259 6295 100 Plus
yki.f 1679 yki.f 183..1188 1..1006 5030 100 Plus
yki-RF 1679 yki-RF 183..1188 1..1006 5030 100 Plus
yki.f 1679 yki.f 1344..1597 1006..1259 1270 100 Plus
yki-RF 1679 yki-RF 1344..1597 1006..1259 1270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19953482..19954394 913..1 4550 99.9 Minus
chr2R 21145070 chr2R 19951997..19952197 1256..1056 1005 100 Minus
chr2R 21145070 chr2R 19953180..19953271 1005..914 460 100 Minus
chr2R 21145070 chr2R 19952278..19952331 1058..1005 270 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1032 CG4005-PD 1..1032 132..1163 5160 100 Plus
yki-RF 1188 CG4005-PF 1..875 132..1006 4375 100 Plus
yki-RG 1188 CG4005-PG 1..875 132..1006 4375 100 Plus
yki-RF 1188 CG4005-PF 1031..1188 1006..1163 790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:08:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1369 CG4005-RD 109..1364 1..1256 6280 100 Plus
yki-RF 1525 CG4005-RF 109..1114 1..1006 5030 100 Plus
yki-RG 1460 CG4005-RG 62..1049 19..1006 4940 100 Plus
yki-RF 1525 CG4005-RF 1270..1520 1006..1256 1255 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
yki-PD 343 CG4005-PD 1..343 132..1160 1668 100 Plus
yki-PF 395 CG4005-PF 1..395 132..1160 1602 86.6 Plus
yki-PG 395 CG4005-PG 1..395 132..1160 1602 86.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24067465..24068377 913..1 4565 100 Minus
2R 25286936 2R 24065977..24066180 1259..1056 1020 100 Minus
2R 25286936 2R 24067163..24067254 1005..914 460 100 Minus
2R 25286936 2R 24066261..24066314 1058..1005 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24068664..24069576 913..1 4565 100 Minus
2R 25260384 2R 24067176..24067379 1259..1056 1020 100 Minus
2R 25260384 2R 24068362..24068453 1005..914 460 100 Minus
2R 25260384 2R 24067460..24067513 1058..1005 270 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:38:58 has no hits.

LD21311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:25:29 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19953482..19954394 1..913 99   Minus
chr2R 19953180..19953271 914..1005 100 <- Minus
chr2R 19952278..19952330 1006..1058 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:55:48 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:04:11 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:51:19 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:48 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:29 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 132..1163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:53:05 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 109..1364 1..1256 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:04:11 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 109..1364 1..1256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:19 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 109..1364 1..1256 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:48 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 109..1364 1..1256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:29 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 109..1364 1..1256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:25:29 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24067465..24068377 1..913 100   Minus
2R 24067163..24067254 914..1005 100 <- Minus
2R 24066261..24066313 1006..1058 100 <- Minus
2R 24065980..24066177 1059..1256 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:19 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19954988..19955900 1..913 100   Minus
arm_2R 19954686..19954777 914..1005 100 <- Minus
arm_2R 19953784..19953836 1006..1058 100 <- Minus
arm_2R 19953503..19953700 1059..1256 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:43 Download gff for LD21311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24068682..24069594 1..913 100   Minus
2R 24068380..24068471 914..1005 100 <- Minus
2R 24067478..24067530 1006..1058 100 <- Minus
2R 24067197..24067394 1059..1256 100 <- Minus

LD21311.pep Sequence

Translation from 62 to 1162

> LD21311.pep
MCACLIAKIILCSFRLYTISAFYMLTTMSASSNTNSLIEKEIDDEDMLSP
IKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFT
PPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQI
QPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQ
PAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRS
YDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYR
QQQQILMAERIKQNESGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVN
PPSSHKPDDLEWYKIN*

LD21311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13481-PA 342 GF13481-PA 2..342 30..366 1290 76.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19955-PA 418 GG19955-PA 1..418 1..366 1736 87.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20170-PA 330 GH20170-PA 5..330 33..366 1049 69.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
yki-PD 343 CG4005-PD 1..343 24..366 1778 100 Plus
yki-PF 395 CG4005-PF 1..395 24..366 1712 86.6 Plus
yki-PG 395 CG4005-PG 1..395 24..366 1712 86.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18856-PA 323 GI18856-PA 4..323 32..366 1086 69.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10424-PA 317 GL10424-PA 2..317 30..366 1281 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17846-PA 317 GA17846-PA 2..317 30..366 1283 80.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18275-PA 391 GM18275-PA 1..391 28..366 1578 86.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24973-PA 366 GD24973-PA 1..366 1..366 1934 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20440-PA 312 GJ20440-PA 4..312 32..366 1080 68.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21386-PA 391 GK21386-PA 1..391 24..366 1080 60.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11487-PA 418 GE11487-PA 1..418 1..366 1712 86.4 Plus

LD21311.hyp Sequence

Translation from 62 to 1162

> LD21311.hyp
MCACLIAKIILCSFRLYTISAFYMLTTMSASSNTNSLIEKEIDDEDMLSP
IKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFT
PPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQI
QPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQ
PAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRS
YDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYR
QQQQILMAERIKQNESGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVN
PPSSHKPDDLEWYKIN*

LD21311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
yki-PD 343 CG4005-PD 1..343 24..366 1778 100 Plus
yki-PF 395 CG4005-PF 1..395 24..366 1712 86.6 Plus
yki-PG 395 CG4005-PG 1..395 24..366 1712 86.6 Plus