Clone LD21748 Report

Search the DGRC for LD21748

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:217
Well:48
Vector:pOT2
Associated Gene/TranscriptNf-YA-RA
Protein status:LD21748.pep: gold
Preliminary Size:2200
Sequenced Size:2043

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3891 2001-01-01 Release 2 assignment
CG3891 2002-05-15 Blastp of sequenced clone
CG3891 2008-04-29 Release 5.5 accounting
CG3891 2008-08-15 Release 5.9 accounting
CG3911 2008-08-15 Release 5.9 accounting
CG3891 2008-12-18 5.12 accounting
CG3911 2008-12-18 5.12 accounting

Clone Sequence Records

LD21748.complete Sequence

2043 bp (2043 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118913

> LD21748.complete
TAAAACTAGGAAAAACAGAAAATTTTATTTTCAATTGTTAAATATCCAAA
CGTAAACAGCCGGAAAATGTCACGACAAGCCTCTCGTTTGGACGCCAAGA
AAGTGTAAGTGTGTGTGTTGGGGGCTTGAGGTTGAGACACGGACACACAG
ACAGGCACAAGCCGACGTGCAATCAGGCAATGGAAAACCATTTCAGCGCC
ACCAGTCGCCCCTCAGCCACGCCCAGAATGTGCACCACCGCCTCTGCCGT
CGGTGCTGCCGCCAGCGCCGCCGCCGCCGCCGGCAACAACAATAACAACA
GCAATAGCAGCAGCAACAACAACGCAACAACCGGCAACAATTTAAGTGTT
AGCACTGCAGCCGGAGGAGCCACAAATGCCGCAGCAACGGCACAACCCAT
CCAAGTGATACCAATGCCCATGCTGCCCACCGGAGCGGCGCAAATCATAA
TTGGCCAGCAGCCACAGGGTCAGGCGACGGCGACGGGTCTGCAGCCACAA
TTGATACCGCTGCAGGCCAACCAGATTATGCTGCAGGCTGCGCAGCAGCA
GCCACAGATGCAGGTGATGCAGCTGCCCGATGGCCAGACTATATTCTATC
AGACGCCCACCATTGCCGCCTTGGATCCGAATGCAGCGGCCAACGCCGCA
GCTGCCATGGCAGCCCAGCCGACGCCGCACTACCTCAATATCAATGGGCA
GCTGGTGCAGATCAATCCAGCACCGAGCGCTAATCAGGCGGCACCCACAG
CTGGGCAACAGATTATAATGGTGCCGCAGACAGCGATGGCAGCGGTGAAT
GCAGCGGCCGCCAATGCCGGAGTAGGCGCCGGAGTGGGCACAGTGGTTAC
CCAACAACAACAGCAGCAGCATCAACAAGTACAATCCCAGACCCAAAACC
AGCAGCAGCAGCAACAGCAGCAGACGGTGGCGGCGGTGGCTGCCAGTGCT
GCAGTCAATAATATAAGCGCCGATGTCAGCACAAGTACAACTGGAACGAA
TACGAACAGCGAGGACGAGAGCTCCAAGGGCGAGGCGGACGAGGAGCCGC
TCTATGTGAATGCCAAGCAGTACAAACGTATTCTCATTCGGCGGCAGGCC
AGGGCCAAGCTAGAGTCGCGCATACCCAAGGAACGGTGCAAGTATCTGCA
CGAATCTCGTCATCGCCACGCCATGAATCGGGCTCGTGGCGAGGGTGGTC
GCTTCCATTCGGCACAGGAGAAGGGCGACCAAGATTCGTCCGGCCCGGAA
GGCGGCAGCATGCCAATGGCGTCCAGTGGCGGCGTCACCCTCAGCCGTGG
CACGGCACGTGCTCCGCCCAAACTGATCGCGCCACATCAAACGCCCAGCA
TTACCATAACGGCGATCAAATCGGAATAGTCGCCTCCTAGCTGTAGGATA
CAAACTAGATAAGATTGTAGTCATAGCGTTTAGTCCTAAGCCAGTCGCTC
TGTGTCCATTTGTCCTCAATCACACCACTTTAGTCGGCTCACATAGTTTT
CATTTTTTTTTTTTTTTCAAAATTAAGTCTTCATATATTATTTTCAAAGG
GAATTTTTGGGTTTTTCTATTTATTTTCATTCACTTAGATTGGAAAAGTG
ATAAGTTCAAGAAAGAGATAATTGTTTTACTTATTATATTCATTTTCTAA
ATCGTTTCTAATTTCTAATATTTATTTTCTGTTAGCCAGCTGTTAAAAAT
TGTTTGTAATTATTAAATAGAGAATTTATTTCATTTACTAGACATTTTCA
AAATTTACACAAGTAATGCAATTATTAATTTAGGGTTTATAGTTCATTTC
AAAATGGAATGGGGAAAGGGCTGCCAATAGTCACCGCAAAACAACAGAGC
TCAACAATATAAGATTCAACAAGGGTGAATGATATAGTCGCCTTCCCCGA
CTATCAGATACCCGTTACTCAGCTTTTGGAAATGCGAACTCGAAATTTCA
AAAGTTCATAAATTTCAAACAAATTTTTTGGCAAATCGATAGAAGACTAA
TAAAATTATGAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAA

LD21748.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-RA 2041 Nf-YA-RA 26..2041 1..2017 10045 99.9 Plus
Bet3-RA 688 Bet3-RA 38..142 1..105 525 100 Plus
Bet3.a 984 Bet3.a 37..141 1..105 525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9431931..9433837 2017..105 9260 99.1 Minus
chr3L 24539361 chr3L 9433994..9434098 105..1 525 100 Minus
chr4 1351717 chr4 441812..441892 1868..1948 270 88.9 Plus
chrX 22417052 chrX 21992370..21992443 1877..1950 265 90.5 Plus
chr3R 27901430 chr3R 8037935..8038008 1950..1877 265 90.5 Minus
chr2R 21145070 chr2R 1776506..1776582 1877..1953 265 89.6 Plus
chr2R 21145070 chr2R 1917430..1917509 1868..1947 265 88.8 Plus
chrU 10048995 chrU 6584136..6584217 1868..1949 260 87.8 Plus
chr2L 23010047 chr2L 22771261..22771342 1949..1868 260 87.8 Minus
chr2L 23010047 chr2L 22778379..22778460 1949..1868 260 87.8 Minus
chr4 1351717 chr4 185897..185983 1864..1950 255 86.2 Plus
chr4 1351717 chr4 402399..402473 1950..1876 255 89.3 Minus
chr3R 27901430 chr3R 27790916..27790987 1877..1948 255 90.3 Plus
chr4 1351717 chr4 688544..688617 1877..1950 250 89.2 Plus
chr4 1351717 chr4 970306..970379 1877..1950 250 89.2 Plus
chrX 22417052 chrX 22380282..22380358 1953..1877 250 88.3 Minus
chr2L 23010047 chr2L 21620728..21620810 1868..1950 250 86.7 Plus
chr2L 23010047 chr2L 21784083..21784168 1862..1947 250 86 Plus
chrXHet 204175 chrXHet 3244..3320 1944..1868 250 88.3 Minus
chrXHet 204175 chrXHet 41335..41417 1868..1950 250 86.7 Plus
chr3LHet 2555433 chr3LHet 1146148..1146230 1868..1950 250 86.7 Plus
chr2L 23010047 chr2L 22722513..22722585 1877..1949 245 89 Plus
chr2L 23010047 chr2L 22746143..22746215 1949..1877 245 89 Minus
chr3L 24539361 chr3L 91003..91074 1877..1948 240 88.9 Plus
chr4 1351717 chr4 863423..863506 1950..1867 240 85.7 Minus
chr2L 23010047 chr2L 22644535..22644624 1957..1868 240 84.4 Minus
chr3RHet 2517486 chr3RHet 1187002..1187082 1950..1870 240 86.4 Minus
chr3L 24539361 chr3L 22501126..22501208 1950..1868 235 85.5 Minus
chr4 1351717 chr4 121200..121273 1950..1877 235 87.8 Minus
chr4 1351717 chr4 256429..256511 1950..1868 235 85.5 Minus
chr4 1351717 chr4 1251660..1251733 1950..1877 235 87.8 Minus
chrX 22417052 chrX 21430312..21430382 1878..1948 235 88.7 Plus
chrX 22417052 chrX 21502933..21503015 1950..1868 235 85.5 Minus
chrX 22417052 chrX 21906888..21906967 1869..1948 235 86.2 Plus
chrX 22417052 chrX 21998396..21998469 1950..1877 235 87.8 Minus
chrX 22417052 chrX 22109663..22109736 1950..1877 235 87.8 Minus
chr3R 27901430 chr3R 228225..228298 1950..1877 235 87.8 Minus
chr3R 27901430 chr3R 27828089..27828156 1883..1950 235 89.7 Plus
chr2R 21145070 chr2R 21019004..21019092 1957..1869 235 84.3 Minus
chrU 10048995 chrU 30416..30489 1950..1877 235 87.8 Minus
chr2L 23010047 chr2L 21940805..21940887 1950..1868 235 85.5 Minus
chrXHet 204175 chrXHet 32434..32516 1868..1950 235 85.5 Plus
chr3L 24539361 chr3L 22749805..22749862 1893..1950 230 93.1 Plus
chr2R 21145070 chr2R 3812829..3812910 1868..1949 230 85.4 Plus
chr2R 21145070 chr2R 21103774..21103846 1950..1878 230 87.7 Minus
chr2L 23010047 chr2L 21724596..21724668 1877..1949 230 87.7 Plus
chr3L 24539361 chr3L 39163..39243 1948..1868 225 85.2 Minus
chr3L 24539361 chr3L 19673565..19673639 1870..1944 225 86.7 Plus
chr4 1351717 chr4 274804..274884 1948..1868 225 85.2 Minus
chrX 22417052 chrX 3688269..3688340 1948..1877 225 87.5 Minus
chrX 22417052 chrX 3697362..3697433 1948..1877 225 87.5 Minus
chrX 22417052 chrX 4021718..4021798 1948..1868 225 85.2 Minus
chrX 22417052 chrX 22362054..22362125 1877..1948 225 87.5 Plus
chr3R 27901430 chr3R 329865..329936 1879..1950 225 87.5 Plus
chr3R 27901430 chr3R 657275..657358 1950..1867 225 84.5 Minus
chr3L 24539361 chr3L 18732726..18732799 1950..1877 220 86.5 Minus
chr3L 24539361 chr3L 24063986..24064065 1947..1868 220 85 Minus
chr3L 24539361 chr3L 24079826..24079902 1953..1877 220 85.7 Minus
chr3L 24539361 chr3L 24134190..24134266 1953..1877 220 85.7 Minus
chr4 1351717 chr4 399605..399687 1868..1950 220 84.3 Plus
chr4 1351717 chr4 402194..402246 1898..1950 220 94.3 Plus
chr4 1351717 chr4 960510..960577 1950..1883 220 88.2 Minus
chrX 22417052 chrX 90825..90907 1950..1868 220 84.3 Minus
chrX 22417052 chrX 6773405..6773487 1950..1868 220 84.3 Minus
chrX 22417052 chrX 18246224..18246306 1950..1868 220 84.3 Minus
chrX 22417052 chrX 19080632..19080714 1867..1949 220 84.3 Plus
chrX 22417052 chrX 21012526..21012608 1950..1868 220 84.3 Minus
chrX 22417052 chrX 21023745..21023827 1950..1868 220 84.3 Minus
chrX 22417052 chrX 21253233..21253306 1877..1950 220 86.5 Plus
chrX 22417052 chrX 21988130..21988212 1868..1950 220 84.3 Plus
chrX 22417052 chrX 22161094..22161164 1948..1878 220 87.3 Minus
chrX 22417052 chrX 22292296..22292381 1866..1951 220 83.7 Plus
chrX 22417052 chrX 22364880..22364962 1868..1950 220 84.3 Plus
chrX 22417052 chrX 22382953..22383017 1956..1892 220 89.2 Minus
chr3R 27901430 chr3R 562235..562317 1950..1868 220 84.3 Minus
chr3R 27901430 chr3R 12480400..12480473 1950..1877 220 86.5 Minus
chr2R 21145070 chr2R 583549..583631 1868..1950 220 84.3 Plus
chr2R 21145070 chr2R 707592..707665 1877..1950 220 86.5 Plus
chr2R 21145070 chr2R 21096834..21096907 1877..1950 220 86.5 Plus
chrU 10048995 chrU 4052846..4052928 1868..1950 220 84.3 Plus
chrU 10048995 chrU 5570460..5570542 1950..1868 220 84.3 Minus
chrU 10048995 chrU 6467814..6467896 1950..1868 220 84.3 Minus
chr2L 23010047 chr2L 116934..117016 1950..1868 220 84.3 Minus
chr2L 23010047 chr2L 3462299..3462381 1868..1950 220 84.3 Plus
chr2L 23010047 chr2L 7232160..7232239 1947..1868 220 85 Minus
chr2L 23010047 chr2L 21300535..21300617 1868..1950 220 84.3 Plus
chr2L 23010047 chr2L 21555823..21555896 1877..1950 220 86.5 Plus
chr3LHet 2555433 chr3LHet 729584..729666 1868..1950 220 84.3 Plus
chr3LHet 2555433 chr3LHet 2003783..2003856 1877..1950 220 86.5 Plus
chr3LHet 2555433 chr3LHet 2158117..2158199 1868..1950 220 84.3 Plus
chr3L 24539361 chr3L 19414513..19414591 1946..1868 215 84.8 Minus
chr3L 24539361 chr3L 22995692..22995770 1948..1870 215 84.8 Minus
chr3L 24539361 chr3L 24062780..24062861 1949..1868 215 84.1 Minus
chrX 22417052 chrX 21352143..21352215 1877..1950 215 89.2 Plus
chr3R 27901430 chr3R 27779922..27780000 1946..1868 215 84.8 Minus
chr2R 21145070 chr2R 804188..804254 1884..1950 215 88.1 Plus
chr2R 21145070 chr2R 1134532..1134610 1957..1879 215 84.8 Minus
chr2R 21145070 chr2R 1682248..1682305 1950..1893 215 91.4 Minus
chr2R 21145070 chr2R 16248351..16248426 1943..1868 215 85.5 Minus
chr2L 23010047 chr2L 17972658..17972736 1946..1868 215 84.8 Minus
chr2L 23010047 chr2L 21381858..21381915 1893..1950 215 91.4 Plus
chr3L 24539361 chr3L 38774..38845 1948..1877 210 86.1 Minus
chr3L 24539361 chr3L 22536872..22536952 1868..1948 210 84 Plus
chr3L 24539361 chr3L 22905148..22905219 1948..1877 210 86.1 Minus
chr3L 24539361 chr3L 24154656..24154730 1953..1879 210 85.3 Minus
chr4 1351717 chr4 254330..254410 1948..1868 210 84 Minus
chr4 1351717 chr4 625166..625237 1877..1948 210 86.1 Plus
chr4 1351717 chr4 637258..637329 1948..1877 210 86.1 Minus
chrX 22417052 chrX 22245303..22245374 1877..1948 210 86.1 Plus
chr2R 21145070 chr2R 1680896..1680952 1868..1924 210 91.2 Plus
chr2L 23010047 chr2L 22336699..22336764 1885..1950 210 87.9 Plus
chr3L 24539361 chr3L 22927330..22927403 1877..1950 205 85.1 Plus
chr3L 24539361 chr3L 23012167..23012249 1950..1868 205 83.1 Minus
chr3L 24539361 chr3L 23758621..23758703 1868..1950 205 83.1 Plus
chr3L 24539361 chr3L 23761312..23761382 1878..1948 205 85.9 Plus
chr3L 24539361 chr3L 24389603..24389673 1953..1883 205 85.9 Minus
chr4 1351717 chr4 75424..75497 1865..1938 205 85.1 Plus
chr4 1351717 chr4 205588..205670 1868..1950 205 83.1 Plus
chr4 1351717 chr4 352921..353000 1868..1947 205 83.8 Plus
chr4 1351717 chr4 534944..535026 1950..1868 205 83.1 Minus
chr4 1351717 chr4 1025531..1025598 1883..1950 205 86.8 Plus
chrX 22417052 chrX 32089..32171 1950..1868 205 83.1 Minus
chrX 22417052 chrX 14015164..14015246 1950..1868 205 83.1 Minus
chrX 22417052 chrX 15823933..15824012 1947..1868 205 83.8 Minus
chrX 22417052 chrX 17443850..17443932 1868..1950 205 83.1 Plus
chrX 22417052 chrX 20246894..20246976 1868..1950 205 83.1 Plus
chrX 22417052 chrX 21286932..21287005 1950..1877 205 85.1 Minus
chrX 22417052 chrX 21469187..21469269 1868..1950 205 83.1 Plus
chrX 22417052 chrX 22140042..22140124 1868..1950 205 83.1 Plus
chrX 22417052 chrX 22181305..22181378 1950..1877 205 85.1 Minus
chr3R 27901430 chr3R 2107..2174 1950..1883 205 86.8 Minus
chr3R 27901430 chr3R 8726..8781 1893..1948 205 91.1 Plus
chr3R 27901430 chr3R 94228..94310 1868..1950 205 83.1 Plus
chr2R 21145070 chr2R 18122..18183 1892..1953 205 88.7 Plus
chr2R 21145070 chr2R 266818..266900 1868..1950 205 83.1 Plus
chr2R 21145070 chr2R 1011853..1011920 1950..1883 205 86.8 Minus
chr2R 21145070 chr2R 1254755..1254828 1877..1950 205 85.1 Plus
chr2R 21145070 chr2R 1497813..1497880 1883..1950 205 86.8 Plus
chr2R 21145070 chr2R 2050087..2050169 1950..1868 205 83.1 Minus
chrU 10048995 chrU 275725..275804 1947..1868 205 83.8 Minus
chrU 10048995 chrU 377178..377260 1868..1950 205 83.1 Plus
chrU 10048995 chrU 1355391..1355455 1950..1886 205 87.7 Minus
chr2L 23010047 chr2L 17456937..17457019 1950..1868 205 83.1 Minus
chr2L 23010047 chr2L 21707237..21707310 1950..1877 205 85.1 Minus
chr2L 23010047 chr2L 21760475..21760548 1950..1877 205 85.1 Minus
chr2L 23010047 chr2L 21774021..21774103 1868..1950 205 83.1 Plus
chr2L 23010047 chr2L 21796315..21796394 1948..1869 205 83.8 Minus
chr3LHet 2555433 chr3LHet 210389..210459 1883..1953 205 85.9 Plus
chr3LHet 2555433 chr3LHet 599380..599462 1950..1868 205 83.1 Minus
chr3LHet 2555433 chr3LHet 853478..853560 1950..1868 205 83.1 Minus
chr3LHet 2555433 chr3LHet 914069..914142 1877..1950 205 85.1 Plus
chr3L 24539361 chr3L 22843126..22843192 1884..1950 200 86.6 Plus
chr3L 24539361 chr3L 23011466..23011547 1869..1950 200 82.9 Plus
chr4 1351717 chr4 958513..958579 1950..1884 200 86.6 Minus
chrX 22417052 chrX 10831174..10831240 1934..1868 200 86.6 Minus
chrX 22417052 chrX 16727647..16727695 1876..1924 200 93.9 Plus
chrX 22417052 chrX 19698605..19698686 1868..1949 200 82.9 Plus
chrX 22417052 chrX 19703171..19703225 1868..1922 200 90.9 Plus
chrX 22417052 chrX 22191035..22191092 1924..1867 200 89.7 Minus
chr3R 27901430 chr3R 132873..132930 1950..1893 200 89.7 Minus
chr3R 27901430 chr3R 239716..239770 1868..1922 200 90.9 Plus
chr3R 27901430 chr3R 422457..422514 1950..1893 200 89.7 Minus
chr2R 21145070 chr2R 264825..264885 1943..1883 200 88.5 Minus
chr2R 21145070 chr2R 593256..593325 1879..1948 200 85.7 Plus
chr2R 21145070 chr2R 1312130..1312205 1961..1886 200 84.2 Minus
chr2R 21145070 chr2R 21081916..21081970 1896..1950 200 90.9 Plus
chr2L 23010047 chr2L 4030096..4030165 1946..1877 200 85.7 Minus
chr2L 23010047 chr2L 22310079..22310160 1948..1867 200 82.9 Minus
chr2L 23010047 chr2L 22316811..22316871 1878..1938 200 88.5 Plus
chr3L 24539361 chr3L 20490539..20490625 1864..1950 195 81.6 Plus
chr3L 24539361 chr3L 23623991..23624071 1868..1948 195 82.7 Plus
chr3L 24539361 chr3L 23637552..23637605 1921..1868 195 90.7 Minus
chr3L 24539361 chr3L 23760608..23760664 1868..1924 195 89.5 Plus
chr4 1351717 chr4 532394..532486 1948..1856 195 80.6 Minus
chr4 1351717 chr4 1001175..1001231 1924..1868 195 89.5 Minus
chrX 22417052 chrX 169271..169342 1939..1868 195 84.7 Minus
chrX 22417052 chrX 182447..182494 1924..1877 195 93.8 Minus
chrX 22417052 chrX 6649738..6649794 1894..1950 195 89.5 Plus
chrX 22417052 chrX 11797006..11797086 1868..1948 195 82.7 Plus
chrX 22417052 chrX 20393642..20393689 1939..1892 195 93.8 Minus
chrX 22417052 chrX 20998226..20998282 1924..1868 195 89.5 Minus
chrX 22417052 chrX 22025429..22025500 1948..1877 195 84.7 Minus
chr2R 21145070 chr2R 1003560..1003613 1897..1950 195 90.7 Plus
chr2R 21145070 chr2R 1100523..1100570 1877..1924 195 93.8 Plus
chr2R 21145070 chr2R 1415410..1415466 1868..1924 195 89.5 Plus
chrU 10048995 chrU 1859145..1859225 1948..1868 195 82.7 Minus
chrU 10048995 chrU 1863950..1864033 1950..1867 195 82.1 Minus
chr2L 23010047 chr2L 21619191..21619271 1868..1948 195 82.7 Plus
chr2L 23010047 chr2L 21921923..21922000 1946..1869 195 83.3 Minus
chr2L 23010047 chr2L 22065993..22066064 1877..1948 195 84.7 Plus
chr2L 23010047 chr2L 22069058..22069126 1877..1945 195 85.5 Plus
chr2L 23010047 chr2L 22162255..22162338 1951..1868 195 82.1 Minus
chr2L 23010047 chr2L 22457732..22457803 1948..1877 195 84.7 Minus
chr2L 23010047 chr2L 22637201..22637272 1877..1948 195 84.7 Plus
chr2L 23010047 chr2L 22650602..22650673 1948..1877 195 84.7 Minus
chr2L 23010047 chr2L 22919978..22920040 1869..1931 195 87.3 Plus
chr3LHet 2555433 chr3LHet 741203..741259 1924..1868 195 89.5 Minus
chr3L 24539361 chr3L 18732555..18732598 2017..1974 190 95.5 Minus
chr3L 24539361 chr3L 19478339..19478421 1950..1868 190 81.9 Minus
chr3L 24539361 chr3L 23017909..23017988 1948..1869 190 82.5 Minus
chr3L 24539361 chr3L 23038167..23038231 1886..1950 190 86.2 Plus
chr3L 24539361 chr3L 23214767..23214819 1898..1950 190 90.6 Plus
chr3L 24539361 chr3L 23709700..23709782 1950..1868 190 81.9 Minus
chr3L 24539361 chr3L 23861010..23861083 1877..1950 190 83.8 Plus
chr3L 24539361 chr3L 24231291..24231373 1868..1950 190 81.9 Plus
chr4 1351717 chr4 471649..471710 1938..1877 190 87.1 Minus
chr4 1351717 chr4 556465..556541 1869..1945 190 83.1 Plus
chr4 1351717 chr4 965370..965440 1877..1947 190 84.5 Plus
chrX 22417052 chrX 599493..599548 1950..1895 190 89.3 Minus
chrX 22417052 chrX 605014..605069 1950..1895 190 89.3 Minus
chrX 22417052 chrX 14705821..14705879 1867..1925 190 88.1 Plus
chrX 22417052 chrX 17511608..17511660 1950..1898 190 90.6 Minus
chr3R 27901430 chr3R 12354..12424 1948..1878 190 84.5 Minus
chr3R 27901430 chr3R 506186..506241 1869..1924 190 89.3 Plus
chr3R 27901430 chr3R 27859839..27859921 1950..1868 190 81.9 Minus
chr3R 27901430 chr3R 27886437..27886516 1868..1947 190 82.5 Plus
chr2R 21145070 chr2R 78566..78636 1954..1884 190 84.5 Minus
chr2R 21145070 chr2R 231127..231209 1868..1950 190 81.9 Plus
chr2R 21145070 chr2R 485149..485216 1950..1883 190 85.3 Minus
chr2R 21145070 chr2R 639512..639579 1883..1950 190 85.3 Plus
chr2R 21145070 chr2R 710417..710463 1901..1947 190 93.6 Plus
chr2R 21145070 chr2R 1203114..1203199 1868..1953 190 81.4 Plus
chr2R 21145070 chr2R 1553297..1553352 1948..1893 190 89.3 Minus
chr2R 21145070 chr2R 2085732..2085796 1950..1886 190 86.2 Minus
chr2R 21145070 chr2R 2835857..2835921 1886..1950 190 86.2 Plus
chrU 10048995 chrU 31099..31181 1868..1950 190 81.9 Plus
chrU 10048995 chrU 249461..249531 1938..1868 190 84.5 Minus
chrU 10048995 chrU 1355471..1355535 1950..1886 190 86.2 Minus
chrU 10048995 chrU 3401825..3401898 1950..1877 190 83.8 Minus
chr2L 23010047 chr2L 18158299..18158363 1950..1886 190 86.2 Minus
chr2L 23010047 chr2L 21263734..21263816 1950..1868 190 81.9 Minus
chr2L 23010047 chr2L 21337211..21337266 1893..1948 190 89.3 Plus
chr2L 23010047 chr2L 21345476..21345537 1945..1884 190 87.1 Minus
chr2L 23010047 chr2L 21617891..21617973 1950..1868 190 81.9 Minus
chr2L 23010047 chr2L 21855383..21855456 1877..1950 190 83.8 Plus
chr2L 23010047 chr2L 22122879..22122946 1883..1950 190 85.3 Plus
chr2L 23010047 chr2L 22177595..22177677 1950..1868 190 81.9 Minus
chr2L 23010047 chr2L 22368463..22368518 1938..1883 190 89.3 Minus
chr2L 23010047 chr2L 22522725..22522798 1877..1950 190 83.8 Plus
chr2L 23010047 chr2L 22607900..22607967 1883..1950 190 85.3 Plus
chr2L 23010047 chr2L 22884484..22884557 1877..1950 190 83.8 Plus
chrXHet 204175 chrXHet 7919..7992 1877..1950 190 83.8 Plus
chr3LHet 2555433 chr3LHet 209008..209075 1950..1883 190 85.3 Minus
chr3LHet 2555433 chr3LHet 482163..482245 1950..1868 190 81.9 Minus
chr3LHet 2555433 chr3LHet 910625..910707 1868..1950 190 81.9 Plus
chr3LHet 2555433 chr3LHet 1227049..1227113 1884..1948 190 86.2 Plus
chr3LHet 2555433 chr3LHet 1305593..1305690 1853..1950 190 79.6 Plus
chr3L 24539361 chr3L 6141550..6141631 1949..1868 185 81.7 Minus
chr3L 24539361 chr3L 6307925..6307982 1924..1867 185 87.9 Minus
chr3L 24539361 chr3L 22629577..22629634 1934..1877 185 87.9 Minus
chr3L 24539361 chr3L 22769471..22769543 1950..1878 185 83.6 Minus
chr3L 24539361 chr3L 22993665..22993740 1952..1877 185 82.9 Minus
chr3L 24539361 chr3L 23044248..23044311 1949..1886 185 85.9 Minus
chr3L 24539361 chr3L 23937060..23937129 1937..1868 185 84.3 Minus
chr3L 24539361 chr3L 24290732..24290810 1868..1946 185 82.3 Plus
chr3L 24539361 chr3L 24480558..24480612 1894..1948 185 89.1 Plus
chr4 1351717 chr4 469741..469807 1938..1872 185 85.1 Minus
chr4 1351717 chr4 941906..941972 1877..1943 185 85.1 Plus
chr3R 27901430 chr3R 351783..351840 1950..1893 185 87.9 Minus
chr3R 27901430 chr3R 416960..417014 1896..1950 185 89.1 Plus
chr3R 27901430 chr3R 19714638..19714695 1878..1935 185 87.9 Plus
chr2R 21145070 chr2R 794460..794508 1931..1883 185 91.8 Minus
chr2R 21145070 chr2R 2834506..2834587 1868..1949 185 81.7 Plus
chr2R 21145070 chr2R 2910461..2910540 1951..1869 185 84.3 Minus
chrU 10048995 chrU 1316849..1316900 1919..1868 185 90.4 Minus
chr2L 23010047 chr2L 10403002..10403056 1870..1924 185 89.1 Plus
chr3LHet 2555433 chr3LHet 231128..231200 1950..1878 185 83.6 Minus
chr3LHet 2555433 chr3LHet 1227373..1227430 1893..1950 185 87.9 Plus
chr3LHet 2555433 chr3LHet 1992547..1992598 1919..1868 185 90.4 Minus
chr3LHet 2555433 chr3LHet 2152496..2152553 1893..1950 185 87.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-RA 1200 CG3891-PA 1..1200 180..1379 6000 100 Plus
Bet3-RA 537 CG3911-PA 1..39 67..105 195 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
CR41598-RA 580 CR41598-RA 464..528 1884..1948 190 86.1 Plus
Su(Ste):CR42418-RA 1265 CR42418-RA 795..876 1868..1950 180 83.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-RA 2055 CG3891-RA 40..2055 1..2017 10035 100 Plus
Bet3-RA 1125 CG3911-RA 40..144 1..105 525 100 Plus
msl-2-RA 3843 CG3241-RA 3255..3337 1950..1868 250 86.7 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-PA 399 CG3891-PA 1..399 180..1376 913 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9440055..9441967 2018..105 9520 99.9 Minus
3L 28110227 3L 9442124..9442228 105..1 525 100 Minus
4 1348131 4 421256..421336 1868..1948 270 88.9 Plus
Y 3667352 Y 10937..11022 1868..1953 265 87.2 Plus
X 23542271 X 22596404..22596477 1877..1950 265 90.5 Plus
2R 25286936 2R 5889187..5889263 1877..1953 265 89.6 Plus
2R 25286936 2R 765879..765960 1868..1949 260 87.8 Plus
2R 25286936 2R 772997..773078 1868..1949 260 87.8 Plus
2L 23513712 2L 22880037..22880118 1949..1868 260 87.8 Minus
2L 23513712 2L 22887155..22887236 1949..1868 260 87.8 Minus
4 1348131 4 165263..165349 1864..1950 255 86.2 Plus
4 1348131 4 381825..381899 1950..1876 255 89.3 Minus
3R 32079331 3R 31968726..31968797 1877..1948 255 90.3 Plus
3L 28110227 3L 25763482..25763564 1868..1950 250 86.7 Plus
4 1348131 4 667990..668063 1877..1950 250 89.2 Plus
4 1348131 4 949789..949862 1877..1950 250 89.2 Plus
X 23542271 X 22984217..22984293 1953..1877 250 88.3 Minus
X 23542271 X 23024426..23024502 1944..1868 250 88.3 Minus
2R 25286936 2R 6030247..6030326 1868..1947 250 87.5 Plus
2L 23513712 2L 3462724..3462806 1868..1950 250 86.7 Plus
2L 23513712 2L 21622234..21622316 1868..1950 250 86.7 Plus
2L 23513712 2L 21785555..21785640 1862..1947 250 86 Plus
3R 32079331 3R 12212548..12212621 1950..1877 250 89.2 Minus
2R 25286936 2R 798100..798172 1877..1949 245 89 Plus
2R 25286936 2R 821731..821803 1949..1877 245 89 Minus
2R 25286936 2R 25133063..25133153 1959..1869 245 84.6 Minus
2L 23513712 2L 22831287..22831359 1877..1949 245 89 Plus
2L 23513712 2L 22854919..22854991 1949..1877 245 89 Minus
3R 32079331 3R 32006007..32006079 1878..1950 245 89 Plus
3L 28110227 3L 91056..91127 1877..1948 240 88.9 Plus
4 1348131 4 842885..842968 1950..1867 240 85.7 Minus
2L 23513712 2L 22753309..22753398 1957..1868 240 84.4 Minus
3R 32079331 3R 2610298..2610378 1950..1870 240 86.4 Minus
3L 28110227 3L 22512218..22512300 1950..1868 235 85.5 Minus
4 1348131 4 100564..100637 1950..1877 235 87.8 Minus
4 1348131 4 235849..235931 1950..1868 235 85.5 Minus
4 1348131 4 1248085..1248158 1950..1877 235 87.8 Minus
X 23542271 X 21565154..21565224 1878..1948 235 88.7 Plus
X 23542271 X 21637775..21637857 1950..1868 235 85.5 Minus
X 23542271 X 22510905..22510984 1869..1948 235 86.2 Plus
X 23542271 X 22602433..22602506 1950..1877 235 87.8 Minus
X 23542271 X 22713688..22713761 1950..1877 235 87.8 Minus
X 23542271 X 22785276..22785349 1950..1877 235 87.8 Minus
X 23542271 X 23053578..23053660 1868..1950 235 85.5 Plus
X 23542271 X 23062479..23062561 1868..1950 235 85.5 Plus
2R 25286936 2R 372584..372657 1950..1877 235 87.8 Minus
2R 25286936 2R 453298..453371 1950..1877 235 87.8 Minus
2L 23513712 2L 21761948..21762021 1950..1877 235 87.8 Minus
2L 23513712 2L 21942280..21942362 1950..1868 235 85.5 Minus
3R 32079331 3R 4402506..4402579 1950..1877 235 87.8 Minus
3L 28110227 3L 19425107..19425185 1946..1868 230 86.1 Minus
3L 28110227 3L 22760900..22760957 1893..1950 230 93.1 Plus
2R 25286936 2R 7925449..7925530 1868..1949 230 85.4 Plus
2R 25286936 2R 25217898..25217970 1950..1878 230 87.7 Minus
2L 23513712 2L 21726083..21726155 1877..1949 230 87.7 Plus
3R 32079331 3R 3032359..3032431 1877..1949 230 87.7 Plus
3L 28110227 3L 39163..39243 1948..1868 225 85.2 Minus
3L 28110227 3L 19684198..19684272 1870..1944 225 86.7 Plus
4 1348131 4 254230..254310 1948..1868 225 85.2 Minus
X 23542271 X 3794873..3794944 1948..1877 225 87.5 Minus
X 23542271 X 3803966..3804037 1948..1877 225 87.5 Minus
X 23542271 X 4128495..4128575 1948..1868 225 85.2 Minus
X 23542271 X 22966001..22966072 1877..1948 225 87.5 Plus
2R 25286936 2R 5124379..5124444 1950..1885 225 89.4 Minus
3R 32079331 3R 4504146..4504217 1879..1950 225 87.5 Plus
3R 32079331 3R 4831579..4831662 1950..1867 225 84.5 Minus
3L 28110227 3L 18743100..18743173 1950..1877 220 86.5 Minus
3L 28110227 3L 24075080..24075159 1947..1868 220 85 Minus
3L 28110227 3L 24090919..24090995 1953..1877 220 85.7 Minus
3L 28110227 3L 24145283..24145359 1953..1877 220 85.7 Minus
3L 28110227 3L 25244106..25244188 1868..1950 220 84.3 Plus
3L 28110227 3L 26721492..26721565 1877..1950 220 86.5 Plus
3L 28110227 3L 26875826..26875908 1868..1950 220 84.3 Plus
3L 28110227 3L 27670315..27670397 1868..1950 220 84.3 Plus
4 1348131 4 379031..379113 1868..1950 220 84.3 Plus
4 1348131 4 381620..381672 1898..1950 220 94.3 Plus
4 1348131 4 939993..940060 1950..1883 220 88.2 Minus
X 23542271 X 193834..193916 1950..1868 220 84.3 Minus
X 23542271 X 6881196..6881278 1950..1868 220 84.3 Minus
X 23542271 X 18357043..18357125 1950..1868 220 84.3 Minus
X 23542271 X 19191722..19191804 1867..1949 220 84.3 Plus
X 23542271 X 21147369..21147451 1950..1868 220 84.3 Minus
X 23542271 X 21158588..21158670 1950..1868 220 84.3 Minus
X 23542271 X 21388075..21388148 1877..1950 220 86.5 Plus
X 23542271 X 22592164..22592246 1868..1950 220 84.3 Plus
X 23542271 X 22765113..22765183 1948..1878 220 87.3 Minus
X 23542271 X 22896300..22896385 1866..1951 220 83.7 Plus
X 23542271 X 22968801..22968883 1868..1950 220 84.3 Plus
X 23542271 X 22986888..22986952 1956..1892 220 89.2 Minus
2R 25286936 2R 366662..366735 1950..1877 220 86.5 Minus
2R 25286936 2R 3070110..3070183 1877..1950 220 86.5 Plus
2R 25286936 2R 4820022..4820095 1877..1950 220 86.5 Plus
2R 25286936 2R 25210966..25211039 1877..1950 220 86.5 Plus
2L 23513712 2L 116897..116979 1950..1868 220 84.3 Minus
2L 23513712 2L 7233148..7233227 1947..1868 220 85 Minus
2L 23513712 2L 21302035..21302117 1868..1950 220 84.3 Plus
2L 23513712 2L 21557328..21557401 1877..1950 220 86.5 Plus
3R 32079331 3R 893575..893657 1868..1950 220 84.3 Plus
3R 32079331 3R 4168583..4168665 1948..1866 220 84.3 Minus
3R 32079331 3R 4736534..4736616 1950..1868 220 84.3 Minus
3R 32079331 3R 16655838..16655911 1950..1877 220 86.5 Minus
3CEN 744266 3CEN 738753..738835 1868..1950 220 84.3 Plus
3L 28110227 3L 23006774..23006852 1948..1870 215 84.8 Minus
3L 28110227 3L 24073874..24073955 1949..1868 215 84.1 Minus
X 23542271 X 19809912..19809993 1868..1949 215 84.1 Plus
X 23542271 X 21486985..21487057 1877..1950 215 89.2 Plus
2R 25286936 2R 5247079..5247157 1957..1879 215 84.8 Minus
2R 25286936 2R 5794860..5794917 1950..1893 215 91.4 Minus
2R 25286936 2R 20361348..20361423 1943..1868 215 85.5 Minus
2L 23513712 2L 17974024..17974102 1946..1868 215 84.8 Minus
2L 23513712 2L 21383343..21383400 1893..1950 215 91.4 Plus
3R 32079331 3R 31957699..31957777 1946..1868 215 84.8 Minus
3L 28110227 3L 38774..38845 1948..1877 210 86.1 Minus
3L 28110227 3L 18742916..18742972 2030..1974 210 91.2 Minus
3L 28110227 3L 22547964..22548044 1868..1948 210 84 Plus
3L 28110227 3L 22916225..22916296 1948..1877 210 86.1 Minus
3L 28110227 3L 24165749..24165823 1953..1879 210 85.3 Minus
4 1348131 4 233749..233829 1948..1868 210 84 Minus
4 1348131 4 604610..604681 1877..1948 210 86.1 Plus
X 23542271 X 6757587..6757643 1894..1950 210 91.2 Plus
X 23542271 X 22849299..22849370 1877..1948 210 86.1 Plus
2R 25286936 2R 2563422..2563481 1877..1936 210 90 Plus
2R 25286936 2R 5793509..5793565 1868..1924 210 91.2 Plus
2L 23513712 2L 22338202..22338267 1885..1950 210 87.9 Plus
3L 28110227 3L 22938408..22938481 1877..1950 205 85.1 Plus
3L 28110227 3L 23023249..23023331 1950..1868 205 83.1 Minus
3L 28110227 3L 23769722..23769804 1868..1950 205 83.1 Plus
3L 28110227 3L 23772413..23772483 1878..1948 205 85.9 Plus
3L 28110227 3L 24400703..24400773 1953..1883 205 85.9 Minus
3L 28110227 3L 24727061..24727131 1883..1953 205 85.9 Plus
3L 28110227 3L 25113924..25114006 1950..1868 205 83.1 Minus
3L 28110227 3L 25368001..25368083 1950..1868 205 83.1 Minus
3L 28110227 3L 25483372..25483445 1877..1950 205 85.1 Plus
3L 28110227 3L 27681643..27681713 1877..1947 205 85.9 Plus
4 1348131 4 54791..54864 1865..1938 205 85.1 Plus
4 1348131 4 184962..185044 1868..1950 205 83.1 Plus
4 1348131 4 332347..332426 1868..1947 205 83.8 Plus
4 1348131 4 514394..514476 1950..1868 205 83.1 Minus
X 23542271 X 135705..135787 1950..1868 205 83.1 Minus
X 23542271 X 14124581..14124663 1950..1868 205 83.1 Minus
X 23542271 X 15934087..15934166 1947..1868 205 83.8 Minus
X 23542271 X 17554501..17554583 1868..1950 205 83.1 Plus
X 23542271 X 21421774..21421847 1950..1877 205 85.1 Minus
X 23542271 X 21604029..21604111 1868..1950 205 83.1 Plus
X 23542271 X 22744030..22744112 1868..1950 205 83.1 Plus
2R 25286936 2R 698577..698656 1947..1868 205 83.8 Minus
2R 25286936 2R 1764817..1764881 1950..1886 205 87.7 Minus
2R 25286936 2R 1996434..1996513 1869..1948 205 83.8 Plus
2R 25286936 2R 3105204..3105277 1877..1950 205 85.1 Plus
2R 25286936 2R 3589511..3589578 1950..1883 205 86.8 Minus
2R 25286936 2R 4008761..4008828 1950..1883 205 86.8 Minus
2R 25286936 2R 4130618..4130679 1892..1953 205 88.7 Plus
2R 25286936 2R 4379244..4379326 1868..1950 205 83.1 Plus
2R 25286936 2R 4695964..4696046 1868..1950 205 83.1 Plus
2R 25286936 2R 5367344..5367417 1877..1950 205 85.1 Plus
2R 25286936 2R 5610440..5610507 1883..1950 205 86.8 Plus
2R 25286936 2R 6162983..6163065 1950..1868 205 83.1 Minus
2L 23513712 2L 17458302..17458384 1950..1868 205 83.1 Minus
2L 23513712 2L 21708733..21708806 1950..1877 205 85.1 Minus
2L 23513712 2L 21775499..21775581 1868..1950 205 83.1 Plus
2L 23513712 2L 21797788..21797867 1948..1869 205 83.8 Minus
2L 23513712 2L 22067391..22067464 1877..1950 205 85.1 Plus
3R 32079331 3R 1839622..1839704 1868..1950 205 83.1 Plus
3R 32079331 3R 3467550..3467632 1868..1950 205 83.1 Plus
3R 32079331 3R 4176385..4176452 1950..1883 205 86.8 Minus
3R 32079331 3R 4183005..4183060 1893..1948 205 91.1 Plus
3R 32079331 3R 4268507..4268589 1868..1950 205 83.1 Plus
3L 28110227 3L 22854210..22854276 1884..1950 200 86.6 Plus
3L 28110227 3L 23022548..23022629 1869..1950 200 82.9 Plus
4 1348131 4 937996..938062 1950..1884 200 86.6 Minus
X 23542271 X 10939862..10939928 1934..1868 200 86.6 Minus
X 23542271 X 16838016..16838064 1876..1924 200 93.9 Plus
X 23542271 X 19814506..19814560 1868..1922 200 90.9 Plus
2R 25286936 2R 917182..917227 1905..1950 200 95.7 Plus
2R 25286936 2R 2109412..2109481 1881..1950 200 85.7 Plus
2R 25286936 2R 3552248..3552305 1950..1893 200 89.7 Minus
2R 25286936 2R 4377251..4377311 1943..1883 200 88.5 Minus
2R 25286936 2R 4705671..4705740 1879..1948 200 85.7 Plus
2R 25286936 2R 4916601..4916667 1884..1950 200 86.6 Plus
2R 25286936 2R 5424774..5424849 1961..1886 200 84.2 Minus
2R 25286936 2R 6254507..6254579 1877..1949 200 84.9 Plus
2R 25286936 2R 25196011..25196065 1896..1950 200 90.9 Plus
2L 23513712 2L 4030669..4030738 1946..1877 200 85.7 Minus
2L 23513712 2L 22311584..22311665 1948..1867 200 82.9 Minus
2L 23513712 2L 22318316..22318376 1878..1938 200 88.5 Plus
3R 32079331 3R 4307153..4307210 1950..1893 200 89.7 Minus
3R 32079331 3R 4413997..4414051 1868..1922 200 90.9 Plus
3R 32079331 3R 4596747..4596804 1950..1893 200 89.7 Minus
3R 32079331 3R 23891218..23891275 1878..1935 200 89.7 Plus
3L 28110227 3L 20501557..20501643 1864..1950 195 81.6 Plus
3L 28110227 3L 23635079..23635159 1868..1948 195 82.7 Plus
3L 28110227 3L 23648641..23648694 1921..1868 195 90.7 Minus
3L 28110227 3L 23771709..23771765 1868..1924 195 89.5 Plus
3L 28110227 3L 25255725..25255781 1924..1868 195 89.5 Minus
4 1348131 4 511844..511936 1948..1856 195 80.6 Minus
4 1348131 4 616688..616759 1948..1877 195 84.7 Minus
4 1348131 4 980673..980729 1924..1868 195 89.5 Minus
X 23542271 X 275261..275332 1939..1868 195 84.7 Minus
X 23542271 X 288443..288490 1924..1877 195 93.8 Minus
X 23542271 X 11905867..11905947 1868..1948 195 82.7 Plus
X 23542271 X 20381434..20381490 1868..1924 195 89.5 Plus
X 23542271 X 20528196..20528243 1939..1892 195 93.8 Minus
X 23542271 X 20806142..20806189 1877..1924 195 93.8 Plus
X 23542271 X 21133069..21133125 1924..1868 195 89.5 Minus
X 23542271 X 22629458..22629529 1948..1877 195 84.7 Minus
2R 25286936 2R 2247074..2247154 1950..1870 195 82.7 Minus
2R 25286936 2R 5116070..5116123 1897..1950 195 90.7 Plus
2R 25286936 2R 5213076..5213123 1877..1924 195 93.8 Plus
2R 25286936 2R 5528054..5528110 1868..1924 195 89.5 Plus
2L 23513712 2L 21620697..21620777 1868..1948 195 82.7 Plus
2L 23513712 2L 21923395..21923472 1946..1869 195 83.3 Minus
2L 23513712 2L 22163720..22163803 1951..1868 195 82.1 Minus
2L 23513712 2L 22566494..22566565 1948..1877 195 84.7 Minus
2L 23513712 2L 22745975..22746046 1877..1948 195 84.7 Plus
2L 23513712 2L 22759376..22759447 1948..1877 195 84.7 Minus
2L 23513712 2L 23028740..23028802 1869..1931 195 87.3 Plus
3R 32079331 3R 593172..593252 1948..1868 195 82.7 Minus
3R 32079331 3R 597977..598060 1950..1867 195 82.1 Minus
3R 32079331 3R 2392551..2392595 1974..2018 195 95.6 Plus
3R 32079331 3R 2941273..2941344 1868..1939 195 84.7 Plus
3L 28110227 3L 19488904..19488986 1950..1868 190 81.9 Minus
3L 28110227 3L 23028991..23029070 1948..1869 190 82.5 Minus
3L 28110227 3L 23049249..23049313 1886..1950 190 86.2 Plus
3L 28110227 3L 23225835..23225887 1898..1950 190 90.6 Plus
3L 28110227 3L 23720794..23720876 1950..1868 190 81.9 Minus
3L 28110227 3L 23872110..23872183 1877..1950 190 83.8 Plus
3L 28110227 3L 24242383..24242465 1868..1950 190 81.9 Plus
3L 28110227 3L 24725679..24725746 1950..1883 190 85.3 Minus
3L 28110227 3L 24998835..24998917 1950..1868 190 81.9 Minus
4 1348131 4 451090..451151 1938..1877 190 87.1 Minus
4 1348131 4 535915..535991 1869..1945 190 83.1 Plus
4 1348131 4 944853..944923 1877..1947 190 84.5 Plus
4 1348131 4 1004996..1005063 1883..1950 190 85.3 Plus
X 23542271 X 705512..705567 1950..1895 190 89.3 Minus
2R 25286936 2R 367346..367428 1868..1950 190 81.9 Plus
2R 25286936 2R 373268..373350 1868..1950 190 81.9 Plus
2R 25286936 2R 453981..454063 1868..1950 190 81.9 Plus
2R 25286936 2R 672313..672383 1938..1868 190 84.5 Minus
2L 23513712 2L 18159651..18159715 1950..1886 190 86.2 Minus
2L 23513712 2L 21265225..21265307 1950..1868 190 81.9 Minus
2L 23513712 2L 21338688..21338743 1893..1948 190 89.3 Plus
2L 23513712 2L 21346953..21347014 1945..1884 190 87.1 Minus
2L 23513712 2L 21619397..21619479 1950..1868 190 81.9 Minus
2L 23513712 2L 21856864..21856937 1877..1950 190 83.8 Plus
2L 23513712 2L 22070468..22070529 1877..1938 190 87.1 Plus
2L 23513712 2L 22124338..22124405 1883..1950 190 85.3 Plus
2L 23513712 2L 22179071..22179153 1950..1868 190 81.9 Minus
2L 23513712 2L 22369955..22370010 1938..1883 190 89.3 Minus
2L 23513712 2L 22631504..22631577 1877..1950 190 83.8 Plus
2L 23513712 2L 22716670..22716737 1883..1950 190 85.3 Plus
2L 23513712 2L 22993245..22993318 1877..1950 190 83.8 Plus
3R 32079331 3R 889884..889951 1950..1883 190 85.3 Minus
3R 32079331 3R 2417530..2417603 1950..1877 190 83.8 Minus
3R 32079331 3R 4086029..4086111 1950..1868 190 81.9 Minus
3R 32079331 3R 4186633..4186703 1948..1878 190 84.5 Minus
3R 32079331 3R 32037753..32037835 1950..1868 190 81.9 Minus
3R 32079331 3R 32064337..32064416 1868..1947 190 82.5 Plus
4 1348131 4 449182..449248 1938..1872 185 85.1 Minus
4 1348131 4 921374..921440 1877..1943 185 85.1 Plus
Y 3667352 Y 3569751..3569805 1896..1950 185 89.1 Plus
2L 23513712 2L 10404149..10404203 1870..1924 185 89.1 Plus
2L 23513712 2L 22524348..22524414 1950..1884 185 85.1 Minus
2L 23513712 2L 23315224..23315281 1950..1893 185 87.9 Minus
3R 32079331 3R 3510863..3510932 1947..1878 185 84.3 Minus
3R 32079331 3R 4075862..4075943 1950..1868 185 84.3 Minus
3R 32079331 3R 4128532..4128577 1879..1924 185 93.5 Plus
3R 32079331 3R 4526065..4526122 1950..1893 185 87.9 Minus
3R 32079331 3R 4591250..4591304 1896..1950 185 89.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9433155..9435067 2018..105 9530 99.9 Minus
3L 28103327 3L 9435224..9435328 105..1 525 100 Minus
4 1331231 4 421256..421336 1868..1948 270 88.8 Plus
2R 25260384 2R 5890386..5890462 1877..1953 265 89.6 Plus
X 23527363 X 22581496..22581569 1877..1950 265 90.5 Plus
Unmapped_scaffold_57 13063 Unmapped_scaffold_57 11065..11150 1953..1868 265 87.2 Minus
Y 3410481 Y 2857719..2857804 1868..1953 265 87.2 Plus
2R 25260384 2R 772997..773078 1868..1949 260 87.8 Plus
2R 25260384 2R 765879..765960 1868..1949 260 87.8 Plus
2L 23513712 2L 22887155..22887236 1949..1868 260 87.8 Minus
2L 23513712 2L 22880037..22880118 1949..1868 260 87.8 Minus
3R 31820162 3R 31709557..31709628 1877..1948 255 90.2 Plus
4 1331231 4 165263..165349 1864..1950 255 86.2 Plus
4 1331231 4 381825..381899 1950..1876 255 89.3 Minus
3L 28103327 3L 25756582..25756664 1868..1950 250 86.7 Plus
2R 25260384 2R 6031446..6031525 1868..1947 250 87.5 Plus
X 23527363 X 23009518..23009594 1944..1868 250 88.3 Minus
X 23527363 X 22969309..22969385 1953..1877 250 88.3 Minus
2L 23513712 2L 21622234..21622316 1868..1950 250 86.7 Plus
2L 23513712 2L 3462724..3462806 1868..1950 250 86.7 Plus
2L 23513712 2L 21785555..21785640 1862..1947 250 86 Plus
3R 31820162 3R 11953379..11953452 1950..1877 250 89.1 Minus
4 1331231 4 949789..949862 1877..1950 250 89.1 Plus
4 1331231 4 667990..668063 1877..1950 250 89.1 Plus
2R 25260384 2R 798100..798172 1877..1949 245 89 Plus
2R 25260384 2R 821731..821803 1949..1877 245 89 Minus
2R 25260384 2R 25134262..25134352 1959..1869 245 84.6 Minus
2L 23513712 2L 22831287..22831359 1877..1949 245 89 Plus
2L 23513712 2L 22854919..22854991 1949..1877 245 89 Minus
3R 31820162 3R 31746838..31746910 1878..1950 245 89 Plus
3L 28103327 3L 91056..91127 1877..1948 240 88.8 Plus
2L 23513712 2L 22753309..22753398 1957..1868 240 84.4 Minus
3R 31820162 3R 2407876..2407956 1950..1870 240 86.4 Minus
4 1331231 4 842885..842968 1950..1867 240 85.7 Minus
3L 28103327 3L 22505318..22505400 1950..1868 235 85.5 Minus
2R 25260384 2R 453298..453371 1950..1877 235 87.8 Minus
2R 25260384 2R 372584..372657 1950..1877 235 87.8 Minus
X 23527363 X 21550246..21550316 1878..1948 235 88.7 Plus
X 23527363 X 22495997..22496076 1869..1948 235 86.2 Plus
X 23527363 X 23047571..23047653 1868..1950 235 85.5 Plus
X 23527363 X 23038670..23038752 1868..1950 235 85.5 Plus
X 23527363 X 22770368..22770441 1950..1877 235 87.8 Minus
X 23527363 X 22698780..22698853 1950..1877 235 87.8 Minus
X 23527363 X 22587525..22587598 1950..1877 235 87.8 Minus
X 23527363 X 21622867..21622949 1950..1868 235 85.5 Minus
2L 23513712 2L 21761948..21762021 1950..1877 235 87.8 Minus
2L 23513712 2L 21942280..21942362 1950..1868 235 85.5 Minus
3R 31820162 3R 4143337..4143410 1950..1877 235 87.8 Minus
4 1331231 4 1231185..1231258 1950..1877 235 87.8 Minus
4 1331231 4 100564..100637 1950..1877 235 87.8 Minus
4 1331231 4 235849..235931 1950..1868 235 85.5 Minus
3L 28103327 3L 22754000..22754057 1893..1950 230 93.1 Plus
3L 28103327 3L 19418207..19418285 1946..1868 230 86 Minus
2R 25260384 2R 7926648..7926729 1868..1949 230 85.3 Plus
2R 25260384 2R 25219097..25219169 1950..1878 230 87.6 Minus
2L 23513712 2L 21726083..21726155 1877..1949 230 87.6 Plus
3R 31820162 3R 2829937..2830009 1877..1949 230 87.6 Plus
3L 28103327 3L 19677298..19677372 1870..1944 225 86.6 Plus
3L 28103327 3L 39163..39243 1948..1868 225 85.1 Minus
2R 25260384 2R 5125578..5125643 1950..1885 225 89.3 Minus
X 23527363 X 22951093..22951164 1877..1948 225 87.5 Plus
X 23527363 X 21472077..21472149 1877..1950 225 89.1 Plus
X 23527363 X 3812064..3812135 1948..1877 225 87.5 Minus
X 23527363 X 3802971..3803042 1948..1877 225 87.5 Minus
X 23527363 X 4136593..4136673 1948..1868 225 85.1 Minus
3R 31820162 3R 4244977..4245048 1879..1950 225 87.5 Plus
3R 31820162 3R 4572410..4572493 1950..1867 225 84.5 Minus
4 1331231 4 254230..254310 1948..1868 225 85.1 Minus
3L 28103327 3L 26714592..26714665 1877..1950 220 86.4 Plus
3L 28103327 3L 27663415..27663497 1868..1950 220 84.3 Plus
3L 28103327 3L 26868926..26869008 1868..1950 220 84.3 Plus
3L 28103327 3L 25237206..25237288 1868..1950 220 84.3 Plus
3L 28103327 3L 18736200..18736273 1950..1877 220 86.4 Minus
3L 28103327 3L 24138383..24138459 1953..1877 220 85.7 Minus
3L 28103327 3L 24084019..24084095 1953..1877 220 85.7 Minus
3L 28103327 3L 24068180..24068259 1947..1868 220 85 Minus
2R 25260384 2R 25212165..25212238 1877..1950 220 86.4 Plus
2R 25260384 2R 4821221..4821294 1877..1950 220 86.4 Plus
2R 25260384 2R 3070110..3070183 1877..1950 220 86.4 Plus
2R 25260384 2R 366662..366735 1950..1877 220 86.4 Minus
X 23527363 X 21373167..21373240 1877..1950 220 86.4 Plus
X 23527363 X 22953893..22953975 1868..1950 220 84.3 Plus
X 23527363 X 22577256..22577338 1868..1950 220 84.3 Plus
X 23527363 X 19199820..19199902 1867..1949 220 84.3 Plus
X 23527363 X 22881392..22881477 1866..1951 220 83.7 Plus
X 23527363 X 22971980..22972044 1956..1892 220 89.2 Minus
X 23527363 X 22750205..22750275 1948..1878 220 87.3 Minus
X 23527363 X 21143680..21143762 1950..1868 220 84.3 Minus
X 23527363 X 21132461..21132543 1950..1868 220 84.3 Minus
X 23527363 X 18365141..18365223 1950..1868 220 84.3 Minus
X 23527363 X 6889294..6889376 1950..1868 220 84.3 Minus
X 23527363 X 201932..202014 1950..1868 220 84.3 Minus
2L 23513712 2L 21557328..21557401 1877..1950 220 86.4 Plus
2L 23513712 2L 21302035..21302117 1868..1950 220 84.3 Plus
2L 23513712 2L 7233148..7233227 1947..1868 220 85 Minus
2L 23513712 2L 116897..116979 1950..1868 220 84.3 Minus
3R 31820162 3R 691153..691235 1868..1950 220 84.3 Plus
3R 31820162 3R 16396669..16396742 1950..1877 220 86.4 Minus
3R 31820162 3R 4477365..4477447 1950..1868 220 84.3 Minus
3R 31820162 3R 3830021..3830103 1948..1866 220 84.3 Minus
4 1331231 4 381620..381672 1898..1950 220 94.3 Plus
4 1331231 4 379031..379113 1868..1950 220 84.3 Plus
4 1331231 4 939993..940060 1950..1883 220 88.2 Minus
Unimproved_211000022280328_7341_9229 1888 Unimproved_211000022280328_7341_9229 1244..1326 1868..1950 220 84.3 Plus
Unmapped_scaffold_62 167859 Unmapped_scaffold_62 30105..30187 1868..1950 220 84.3 Plus
3L 28103327 3L 24066974..24067055 1949..1868 215 84.1 Minus
3L 28103327 3L 22999874..22999952 1948..1870 215 84.8 Minus
2R 25260384 2R 5796059..5796116 1950..1893 215 91.3 Minus
2R 25260384 2R 20362547..20362622 1943..1868 215 85.5 Minus
2R 25260384 2R 5248278..5248356 1957..1879 215 84.8 Minus
X 23527363 X 19818010..19818091 1868..1949 215 84.1 Plus
2L 23513712 2L 21383343..21383400 1893..1950 215 91.3 Plus
2L 23513712 2L 17974024..17974102 1946..1868 215 84.8 Minus
3R 31820162 3R 31698530..31698608 1946..1868 215 84.8 Minus
3L 28103327 3L 22541064..22541144 1868..1948 210 83.9 Plus
3L 28103327 3L 18736016..18736072 2030..1974 210 91.2 Minus
3L 28103327 3L 22909325..22909396 1948..1877 210 86.1 Minus
3L 28103327 3L 38774..38845 1948..1877 210 86.1 Minus
3L 28103327 3L 24158849..24158923 1953..1879 210 85.3 Minus
2R 25260384 2R 5794708..5794764 1868..1924 210 91.2 Plus
2R 25260384 2R 2563422..2563481 1877..1936 210 90 Plus
X 23527363 X 6765685..6765741 1894..1950 210 91.2 Plus
X 23527363 X 22834391..22834462 1877..1948 210 86.1 Plus
2L 23513712 2L 22338202..22338267 1885..1950 210 87.8 Plus
4 1331231 4 604610..604681 1877..1948 210 86.1 Plus
4 1331231 4 233749..233829 1948..1868 210 83.9 Minus
3L 28103327 3L 22931508..22931581 1877..1950 205 85.1 Plus
3L 28103327 3L 27674743..27674813 1877..1947 205 85.9 Plus
3L 28103327 3L 24720161..24720231 1883..1953 205 85.9 Plus
3L 28103327 3L 23765513..23765583 1878..1948 205 85.9 Plus
3L 28103327 3L 25476472..25476545 1877..1950 205 85.1 Plus
3L 28103327 3L 23762822..23762904 1868..1950 205 83.1 Plus
3L 28103327 3L 24393803..24393873 1953..1883 205 85.9 Minus
3L 28103327 3L 25361101..25361183 1950..1868 205 83.1 Minus
3L 28103327 3L 25107024..25107106 1950..1868 205 83.1 Minus
3L 28103327 3L 23016349..23016431 1950..1868 205 83.1 Minus
2R 25260384 2R 1996434..1996513 1869..1948 205 83.7 Plus
2R 25260384 2R 4131817..4131878 1892..1953 205 88.7 Plus
2R 25260384 2R 5611639..5611706 1883..1950 205 86.7 Plus
2R 25260384 2R 5368543..5368616 1877..1950 205 85.1 Plus
2R 25260384 2R 3105204..3105277 1877..1950 205 85.1 Plus
2R 25260384 2R 4697163..4697245 1868..1950 205 83.1 Plus
2R 25260384 2R 4380443..4380525 1868..1950 205 83.1 Plus
2R 25260384 2R 1764817..1764881 1950..1886 205 87.6 Minus
2R 25260384 2R 4009960..4010027 1950..1883 205 86.7 Minus
2R 25260384 2R 3590710..3590777 1950..1883 205 86.7 Minus
2R 25260384 2R 698577..698656 1947..1868 205 83.7 Minus
2R 25260384 2R 6164182..6164264 1950..1868 205 83.1 Minus
X 23527363 X 22729122..22729204 1868..1950 205 83.1 Plus
X 23527363 X 21589121..21589203 1868..1950 205 83.1 Plus
X 23527363 X 17562599..17562681 1868..1950 205 83.1 Plus
X 23527363 X 21406866..21406939 1950..1877 205 85.1 Minus
X 23527363 X 15942185..15942264 1947..1868 205 83.7 Minus
X 23527363 X 14132679..14132761 1950..1868 205 83.1 Minus
X 23527363 X 143803..143885 1950..1868 205 83.1 Minus
2L 23513712 2L 22067391..22067464 1877..1950 205 85.1 Plus
2L 23513712 2L 21775499..21775581 1868..1950 205 83.1 Plus
2L 23513712 2L 21708733..21708806 1950..1877 205 85.1 Minus
2L 23513712 2L 21797788..21797867 1948..1869 205 83.7 Minus
2L 23513712 2L 17458302..17458384 1950..1868 205 83.1 Minus
3R 31820162 3R 3923836..3923891 1893..1948 205 91 Plus
3R 31820162 3R 4009338..4009420 1868..1950 205 83.1 Plus
3R 31820162 3R 3128988..3129070 1868..1950 205 83.1 Plus
3R 31820162 3R 1637200..1637282 1868..1950 205 83.1 Plus
3R 31820162 3R 3917216..3917283 1950..1883 205 86.7 Minus
4 1331231 4 332347..332426 1868..1947 205 83.7 Plus
4 1331231 4 54791..54864 1865..1938 205 85.1 Plus
4 1331231 4 184962..185044 1868..1950 205 83.1 Plus
4 1331231 4 514394..514476 1950..1868 205 83.1 Minus
3L 28103327 3L 22847310..22847376 1884..1950 200 86.5 Plus
3L 28103327 3L 23015648..23015729 1869..1950 200 82.9 Plus
2R 25260384 2R 917182..917227 1905..1950 200 95.6 Plus
2R 25260384 2R 25197210..25197264 1896..1950 200 90.9 Plus
2R 25260384 2R 4917800..4917866 1884..1950 200 86.5 Plus
2R 25260384 2R 4706870..4706939 1879..1948 200 85.7 Plus
2R 25260384 2R 2109412..2109481 1881..1950 200 85.7 Plus
2R 25260384 2R 6255706..6255778 1877..1949 200 84.9 Plus
2R 25260384 2R 3553447..3553504 1950..1893 200 89.6 Minus
2R 25260384 2R 4378450..4378510 1943..1883 200 88.5 Minus
2R 25260384 2R 5425973..5426048 1961..1886 200 84.2 Minus
X 23527363 X 16846114..16846162 1876..1924 200 93.8 Plus
X 23527363 X 19822604..19822658 1868..1922 200 90.9 Plus
X 23527363 X 10947960..10948026 1934..1868 200 86.5 Minus
2L 23513712 2L 22318316..22318376 1878..1938 200 88.5 Plus
2L 23513712 2L 4030669..4030738 1946..1877 200 85.7 Minus
2L 23513712 2L 22311584..22311665 1948..1867 200 82.9 Minus
3R 31820162 3R 4154828..4154882 1868..1922 200 90.9 Plus
3R 31820162 3R 23632049..23632106 1878..1935 200 89.6 Plus
3R 31820162 3R 4337578..4337635 1950..1893 200 89.6 Minus
3R 31820162 3R 4047984..4048041 1950..1893 200 89.6 Minus
4 1331231 4 937996..938062 1950..1884 200 86.5 Minus
3L 28103327 3L 23764809..23764865 1868..1924 195 89.4 Plus
3L 28103327 3L 23628179..23628259 1868..1948 195 82.7 Plus
3L 28103327 3L 20494657..20494743 1864..1950 195 81.6 Plus
3L 28103327 3L 23641741..23641794 1921..1868 195 90.7 Minus
3L 28103327 3L 25248825..25248881 1924..1868 195 89.4 Minus
2R 25260384 2R 5214275..5214322 1877..1924 195 93.7 Plus
2R 25260384 2R 5117269..5117322 1897..1950 195 90.7 Plus
2R 25260384 2R 5529253..5529309 1868..1924 195 89.4 Plus
2R 25260384 2R 2247074..2247154 1950..1870 195 82.7 Minus
2R 25260384 2R 7024241..7024320 1951..1869 195 84.3 Minus
X 23527363 X 20791234..20791281 1877..1924 195 93.7 Plus
X 23527363 X 20366526..20366582 1868..1924 195 89.4 Plus
X 23527363 X 11913965..11914045 1868..1948 195 82.7 Plus
X 23527363 X 20513288..20513335 1939..1892 195 93.7 Minus
X 23527363 X 296541..296588 1924..1877 195 93.7 Minus
X 23527363 X 21118161..21118217 1924..1868 195 89.4 Minus
X 23527363 X 22614550..22614621 1948..1877 195 84.7 Minus
X 23527363 X 283359..283430 1939..1868 195 84.7 Minus
2L 23513712 2L 23028740..23028802 1869..1931 195 87.3 Plus
2L 23513712 2L 22745975..22746046 1877..1948 195 84.7 Plus
2L 23513712 2L 21620697..21620777 1868..1948 195 82.7 Plus
2L 23513712 2L 22759376..22759447 1948..1877 195 84.7 Minus
2L 23513712 2L 22566494..22566565 1948..1877 195 84.7 Minus
2L 23513712 2L 21923395..21923472 1946..1869 195 83.3 Minus
2L 23513712 2L 22163720..22163803 1951..1868 195 82.1 Minus
3R 31820162 3R 2190129..2190173 1974..2018 195 95.5 Plus
3R 31820162 3R 2738851..2738922 1868..1939 195 84.7 Plus
3R 31820162 3R 4332054..4332135 1868..1950 195 84.3 Plus
3R 31820162 3R 390750..390830 1948..1868 195 82.7 Minus
3R 31820162 3R 3737300..3737381 1950..1868 195 84.3 Minus
3R 31820162 3R 395555..395638 1950..1867 195 82.1 Minus
4 1331231 4 980673..980729 1924..1868 195 89.4 Minus
4 1331231 4 616688..616759 1948..1877 195 84.7 Minus
4 1331231 4 511844..511936 1948..1856 195 80.6 Minus
3L 28103327 3L 23042349..23042413 1886..1950 190 86.1 Plus
3L 28103327 3L 23218935..23218987 1898..1950 190 90.5 Plus
3L 28103327 3L 25837483..25837547 1884..1948 190 86.1 Plus
3L 28103327 3L 23865210..23865283 1877..1950 190 83.7 Plus
3L 28103327 3L 25473028..25473110 1868..1950 190 81.9 Plus
3L 28103327 3L 24235483..24235565 1868..1950 190 81.9 Plus
3L 28103327 3L 25916034..25916131 1853..1950 190 79.5 Plus
3L 28103327 3L 24718779..24718846 1950..1883 190 85.2 Minus
3L 28103327 3L 23022091..23022170 1948..1869 190 82.5 Minus
3L 28103327 3L 24991935..24992017 1950..1868 190 81.9 Minus
2R 25260384 2R 4824047..4824093 1901..1947 190 93.6 Plus
2R 25260384 2R 6949671..6949735 1886..1950 190 86.1 Plus
2R 25260384 2R 4753127..4753194 1883..1950 190 85.2 Plus
2R 25260384 2R 3375029..3375108 1870..1949 190 82.5 Plus
X 23527363 X 14823669..14823727 1867..1925 190 88.1 Plus
X 23527363 X 23014192..23014265 1877..1950 190 83.7 Plus
2L 23513712 2L 21338688..21338743 1893..1948 190 89.2 Plus
2L 23513712 2L 22070468..22070529 1877..1938 190 87 Plus
2L 23513712 2L 22716670..22716737 1883..1950 190 85.2 Plus
2L 23513712 2L 22124338..22124405 1883..1950 190 85.2 Plus
2L 23513712 2L 22993245..22993318 1877..1950 190 83.7 Plus
2L 23513712 2L 22631504..22631577 1877..1950 190 83.7 Plus
2L 23513712 2L 21856864..21856937 1877..1950 190 83.7 Plus
2L 23513712 2L 22369955..22370010 1938..1883 190 89.2 Minus
2L 23513712 2L 21346953..21347014 1945..1884 190 87 Minus
2L 23513712 2L 18159651..18159715 1950..1886 190 86.1 Minus
2L 23513712 2L 22154427..22154493 1949..1885 190 88 Minus
2L 23513712 2L 22179071..22179153 1950..1868 190 81.9 Minus
2L 23513712 2L 21619397..21619479 1950..1868 190 81.9 Minus
2L 23513712 2L 21265225..21265307 1950..1868 190 81.9 Minus
3R 31820162 3R 31805168..31805247 1868..1947 190 82.5 Plus
3R 31820162 3R 687462..687529 1950..1883 190 85.2 Minus
3R 31820162 3R 3927464..3927534 1948..1878 190 84.5 Minus
3R 31820162 3R 2215108..2215181 1950..1877 190 83.7 Minus
3R 31820162 3R 31778584..31778666 1950..1868 190 81.9 Minus
3R 31820162 3R 3747467..3747549 1950..1868 190 81.9 Minus
4 1331231 4 1004996..1005063 1883..1950 190 85.2 Plus
4 1331231 4 944853..944923 1877..1947 190 84.5 Plus
4 1331231 4 535915..535991 1869..1945 190 83.1 Plus
4 1331231 4 451090..451151 1938..1877 190 87 Minus
4 1331231 4 602220..602301 1868..1949 170 80.4 Plus
4 1331231 4 602401..602435 1960..1994 145 94.2 Plus
Blast to na_te.dros performed 2014-11-26 19:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 525..604 1944..1865 274 82.5 Minus

LD21748.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:19:51 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9433994..9434098 1..105 100   Minus
chr3L 9431931..9433836 106..2017 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:16 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
CG3891-RA 1..1200 180..1379 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:33 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 1..1200 180..1379 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:41 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 1..1200 180..1379 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:08 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
CG3891-RA 1..1200 180..1379 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:51 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 1..1200 180..1379 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:05 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:24 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
CG3891-RA 26..2041 1..2017 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:33 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 26..2041 1..2017 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:41 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 40..2055 1..2017 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:08 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
CG3891-RA 26..2041 1..2017 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:51 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YA-RA 40..2055 1..2017 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:19:51 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9442124..9442228 1..105 100   Minus
3L 9440056..9441966 106..2017 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:41 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9435224..9435328 1..105 100   Minus
arm_3L 9433156..9435066 106..2017 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:30 Download gff for LD21748.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9435224..9435328 1..105 100   Minus
3L 9433156..9435066 106..2017 99 <- Minus

LD21748.pep Sequence

Translation from 179 to 1378

> LD21748.pep
MENHFSATSRPSATPRMCTTASAVGAAASAAAAAGNNNNNSNSSSNNNAT
TGNNLSVSTAAGGATNAAATAQPIQVIPMPMLPTGAAQIIIGQQPQGQAT
ATGLQPQLIPLQANQIMLQAAQQQPQMQVMQLPDGQTIFYQTPTIAALDP
NAAANAAAAMAAQPTPHYLNINGQLVQINPAPSANQAAPTAGQQIIMVPQ
TAMAAVNAAAANAGVGAGVGTVVTQQQQQQHQQVQSQTQNQQQQQQQQTV
AAVAASAAVNNISADVSTSTTGTNTNSEDESSKGEADEEPLYVNAKQYKR
ILIRRQARAKLESRIPKERCKYLHESRHRHAMNRARGEGGRFHSAQEKGD
QDSSGPEGGSMPMASSGGVTLSRGTARAPPKLIAPHQTPSITITAIKSE*

LD21748.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24667-PA 353 GF24667-PA 19..350 48..399 1018 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14038-PA 378 GG14038-PA 36..378 55..399 1075 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15528-PA 359 GH15528-PA 55..359 101..399 810 71.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-PA 399 CG3891-PA 1..399 1..399 2001 100 Plus
Hmx-PE 592 CG43748-PE 170..439 1..289 165 25.9 Plus
Hmx-PC 592 CG43748-PC 170..439 1..289 165 25.9 Plus
Hmx-PD 718 CG43748-PD 170..439 1..289 165 25.9 Plus
bun-PF 1097 CG42281-PM 604..879 27..297 155 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16805-PA 369 GI16805-PA 250..369 278..399 587 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17755-PA 360 GA17755-PA 24..360 53..399 1004 78.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12551-PA 369 GJ12551-PA 21..369 51..399 934 75.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21241-PA 380 GE21241-PA 38..380 57..399 1180 94.2 Plus

LD21748.hyp Sequence

Translation from 179 to 1378

> LD21748.hyp
MENHFSATSRPSATPRMCTTASAVGAAASAAAAAGNNNNNSNSSSNNNAT
TGNNLSVSTAAGGATNAAATAQPIQVIPMPMLPTGAAQIIIGQQPQGQAT
ATGLQPQLIPLQANQIMLQAAQQQPQMQVMQLPDGQTIFYQTPTIAALDP
NAAANAAAAMAAQPTPHYLNINGQLVQINPAPSANQAAPTAGQQIIMVPQ
TAMAAVNAAAANAGVGAGVGTVVTQQQQQQHQQVQSQTQNQQQQQQQQTV
AAVAASAAVNNISADVSTSTTGTNTNSEDESSKGEADEEPLYVNAKQYKR
ILIRRQARAKLESRIPKERCKYLHESRHRHAMNRARGEGGRFHSAQEKGD
QDSSGPEGGSMPMASSGGVTLSRGTARAPPKLIAPHQTPSITITAIKSE*

LD21748.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YA-PA 399 CG3891-PA 1..399 1..399 2001 100 Plus
Hmx-PE 592 CG43748-PE 170..439 1..289 165 25.9 Plus
Hmx-PC 592 CG43748-PC 170..439 1..289 165 25.9 Plus
Hmx-PD 718 CG43748-PD 170..439 1..289 165 25.9 Plus
bun-PF 1097 CG42281-PM 604..879 27..297 155 27.2 Plus