Clone LD21953 Report

Search the DGRC for LD21953

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:219
Well:53
Vector:pOT2
Associated Gene/TranscriptRab35-RA
Protein status:LD21953.pep: gold
Preliminary Size:2200
Sequenced Size:2025

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9575 2002-03-19 Blastp of sequenced clone
CG9575 2003-01-01 Sim4 clustering to Release 3
Rab35 2008-04-29 Release 5.5 accounting
Rab35 2008-08-15 Release 5.9 accounting
Rab35 2008-12-18 5.12 accounting

Clone Sequence Records

LD21953.complete Sequence

2025 bp (2025 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094795

> LD21953.complete
GCGTTAGCAATAGTTTATCCAGAATATGAATTAACCAGAATTAATCCGCA
ACGCCGACGCCCACAAATTCCCACAAATCGTCGTCCTTTCAGCGCTGCAA
GAGCAACCCGGAAGCTGGAAAGTTCGAGACCGCCGAGAAGCCCAATATAA
ATTCAACAGTCAGCCAGAGCTTCACTCCTGTGTGTGTGTGCGTGCGTGCG
TATGTGTTCGTGTGTTGTGTCTGTGCTACAGTGTTGGAGAGAGCGAGACG
CACGATTGCGAGGGAGTCGAGCTTTGCGAAAATTTGCCAGCCTATATTGA
AATATTTTCGGCACCAAATCGCCGTCTTATCCGCCAGCAAGCCATTGGAT
CTGATGGAAATGAGCCTGCCGCTCGATTTCTCTTCGCAAATCCGCTGTTA
AAGCAAAAGCAACAATTGTACCAGTGGAGCCAAAAAAAGAGAAACACACC
TACCTAATCAAAGGAAATTAAATAACAAGGCGGCGGCAACAACACTTACA
TAAATTAACTCGCAACGCAACAACACTAATAACTATAGCTTATCACACAG
CAACAAAAACATCAGCAACAGCAGCAAAAACAACAACAACAACAGACCAG
CAGCCAGAAAGAACAACAGCTTATCTCAGATATTCAGCCGGCTGCACCAG
TGCGAGCGAGAGGGTCGTAGCTTGGGGCGAAAGAGAGGGCGCTTCCGAGA
GAGTGCGAAAGAGAGAGAGAGAGAGAGTAAGCGCAGGGAGTGTGCTCCTG
TGTGTGTGAGTGTGGGAGCAGGCAGCAGAAAAAAAGAAAACAAAAGTATA
TTTTGCATTGTTCGACGCGCCTAACTGTAAATATAAAAGCACTTGCAAAA
ACAAGGAAAAACACAGAAAAACAGCGAAAAAACGTCGAAAAATGGCACGC
GGCTTCGATCATCTATTCAAGTTGCTAATAATCGGCGATAGCGGCGTGGG
CAAGTCGTCGCTGCTCATCCGGTTCTCGGACGACACATTCTCAGGCAGTT
ACATCACCACCATCGGCGTGGACTTTAAGATCCGCACCGTGGACATCGAG
GGCATGCGCGTAAAGCTGCAGATCTGGGACACGGCCGGGCAGGAGCGCTT
CCGGACAATCACCAGCACCTACTACCGCGGCACCCACGGCGTCATTGTCG
TCTACGACGTCACGAACGGCGAATCCTTTGCGAACGTCCGCCGCTGGCTG
GAGGAGATCCAGAATAACTGCGATGTGGTTAAAAAAGTATTAGTGGGCAA
CAAGAACGACGATCCGGACAGGAAGGTGGTCATTACCGAAGACGCGCAGC
GGTTTGCGAAACAAATGGACATCGAGCTATTCGAGACATCTGCCAAAGAC
AACATAAACGTGGAGAACATGTTCTTGTCGATTACGCGACAGGTGCTCGA
TCACAAGCTGCGCACCTCCCCCAACGAGCAGCAGAAGGACACGCTCCATC
TGAAGCCCAATCCCAAGGGCAGCAAGGGTGGGAAGTGCTGCAGGTGAAAG
CGGCTCCGGCACGGGAGCTGGCATTGCAACTGGACCGACGGCGACGGCGG
CGGCGGCGGCGGCGGCGGGACGGGAATTGGAACTGAAATTAGGACCAGGA
CCTGGATCAACTTCGGGGGCGGACGGAATCGTTGTGGGGGCGCGTAGTTT
GTAGGGTTCTTGGCTTACGATTCGACACAGACACTCACTCACATAGACAT
AGCTAACACCACCAAACAACCAACAACAAGAAACCACACAAAGCAAACAA
CACGAGACAACTGAACAACACTCACACCCACTAGAGACAACAATTTTTTT
TGTTTTGTTTTTTTTTTTCCTCCTCAGTTTTATTCGGAATAATGCCAGAT
AGCCGTAAATTAAAGTGTAAAAGTGTAAAGCGCAATTAAATGTATTTAGC
AATTTATATACATATTAATATATACATACATAAACAAAATTGAAACAAAT
TGCATATTTATATACAAGAATATATTTATATTTCAAACGGAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

LD21953.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35.b 3325 Rab35.b 53..2046 1..1994 9970 100 Plus
Rab35-RA 2850 Rab35-RA 136..2129 1..1994 9970 100 Plus
Rab35.a 2629 Rab35.a 1..1243 1..1243 6215 100 Plus
Rab35.a 2629 Rab35.a 1266..2018 1242..1994 3765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20047449..20048392 944..1 4720 100 Minus
chrX 22417052 chrX 20045646..20046392 1990..1242 3605 99.3 Minus
chrX 22417052 chrX 20046524..20046824 1243..943 1505 100 Minus
chrX 22417052 chrX 12352478..12352597 1167..1048 195 77.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 606 CG9575-PB 1..606 892..1497 3030 100 Plus
Rab35-RD 606 CG9575-PD 1..606 892..1497 3030 100 Plus
Rab35-RA 606 CG9575-PA 1..606 892..1497 3030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 2024 CG9575-RB 35..2024 1..1990 9950 100 Plus
Rab35-RD 3348 CG9575-RD 35..2024 1..1990 9950 100 Plus
Rab35-RA 2635 CG9575-RA 35..2024 1..1990 9950 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-PB 201 CG9575-PB 4..191 901..1464 972 100 Plus
Rab35-PD 201 CG9575-PD 4..191 901..1464 972 100 Plus
Rab35-PA 201 CG9575-PA 4..191 901..1464 972 100 Plus
Rab35-PC 190 CG9575-PC 8..180 946..1464 893 100 Plus
Rab1-PA 205 CG3320-PA 8..184 904..1440 531 58.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20158895..20159838 944..1 4720 100 Minus
X 23542271 X 20157086..20157838 1994..1242 3765 100 Minus
X 23542271 X 20157970..20158270 1243..943 1505 100 Minus
X 23542271 X 12461504..12461623 1167..1048 195 77.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20166993..20167936 944..1 4720 100 Minus
X 23527363 X 20165184..20165936 1994..1242 3765 100 Minus
X 23527363 X 20166068..20166368 1243..943 1505 100 Minus
X 23527363 X 12469602..12469721 1167..1048 195 77.5 Minus
Blast to na_te.dros performed 2014-11-26 21:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 294..343 1884..1933 115 70 Plus

LD21953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:38:55 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20046524..20046823 944..1243 100 <- Minus
chrX 20045646..20046390 1244..1990 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:42 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..606 892..1497 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:28:49 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RB 1..606 892..1497 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:54:44 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..606 892..1497 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:07 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..606 892..1497 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:55 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..606 892..1497 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:55:15 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..1990 1..1990 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:28:49 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..1990 1..1990 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:44 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 35..2024 1..1990 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:07 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..1990 1..1990 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:55 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 35..2024 1..1990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:55 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
X 20158896..20159838 1..943 100   Minus
X 20157970..20158269 944..1243 100 <- Minus
X 20157090..20157836 1244..1990 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:44 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20052929..20053871 1..943 100   Minus
arm_X 20052003..20052302 944..1243 100 <- Minus
arm_X 20051123..20051869 1244..1990 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:34 Download gff for LD21953.complete
Subject Subject Range Query Range Percent Splice Strand
X 20166994..20167936 1..943 100   Minus
X 20166068..20166367 944..1243 100 <- Minus
X 20165188..20165934 1244..1990 100 <- Minus

LD21953.pep Sequence

Translation from 891 to 1496

> LD21953.pep
MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTV
DIEGMRVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVR
RWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMDIELFETS
AKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGGKCC
R*

LD21953.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20451-PA 200 GF20451-PA 1..199 1..200 967 92.5 Plus
Dana\GF17263-PA 205 GF17263-PA 8..184 5..183 551 58.3 Plus
Dana\GF20241-PA 204 GF20241-PA 4..203 3..200 508 47.5 Plus
Dana\GF10843-PA 207 GF10843-PA 1..191 1..189 493 48.2 Plus
Dana\GF11093-PA 220 GF11093-PA 16..218 3..199 458 45.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18010-PA 201 GG18010-PA 1..201 1..201 1063 99.5 Plus
Dere\GG14761-PA 205 GG14761-PA 8..184 5..183 551 58.3 Plus
Dere\GG19277-PA 204 GG19277-PA 4..203 3..200 506 47.5 Plus
Dere\GG13365-PA 207 GG13365-PA 1..191 1..189 493 48.2 Plus
Dere\GG22724-PA 220 GG22724-PA 16..218 3..199 457 44.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24326-PA 201 GH24326-PA 1..200 1..200 901 83.5 Plus
Dgri\GH18937-PA 205 GH18937-PA 4..184 1..183 548 57.6 Plus
Dgri\GH12621-PA 204 GH12621-PA 4..203 3..200 497 47 Plus
Dgri\GH16908-PA 207 GH16908-PA 1..169 1..168 485 50.9 Plus
Dgri\GH24197-PA 220 GH24197-PA 16..184 3..170 454 49.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-PB 201 CG9575-PB 1..201 1..201 1046 100 Plus
Rab35-PD 201 CG9575-PD 1..201 1..201 1046 100 Plus
Rab35-PA 201 CG9575-PA 1..201 1..201 1046 100 Plus
Rab35-PC 190 CG9575-PC 8..190 19..201 953 100 Plus
Rab1-PA 205 CG3320-PA 8..184 5..183 531 58.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14806-PA 201 GI14806-PA 1..200 1..200 939 88 Plus
Dmoj\GI10837-PA 205 GI10837-PA 4..184 1..183 551 57.6 Plus
Dmoj\GI11034-PA 204 GI11034-PA 4..203 3..200 503 47 Plus
Dmoj\GI13664-PA 207 GI13664-PA 1..169 1..168 484 50.9 Plus
Dmoj\GI20173-PA 220 GI20173-PA 16..218 3..199 458 45.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12921-PA 200 GL12921-PA 1..199 1..200 962 91 Plus
Dper\GL27164-PA 205 GL27164-PA 8..184 5..183 551 58.3 Plus
Dper\GL15675-PA 207 GL15675-PA 1..169 1..168 485 50.9 Plus
Dper\GL17187-PA 220 GL17187-PA 16..218 3..199 458 45.1 Plus
Dper\GL13857-PA 213 GL13857-PA 1..196 1..196 436 44.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21885-PA 200 GA21885-PA 1..199 1..200 966 91.5 Plus
Dpse\GA17362-PA 205 GA17362-PA 8..184 5..183 551 58.3 Plus
Dpse\GA26078-PA 204 GA26078-PA 4..203 3..200 493 46.8 Plus
Dpse\GA23499-PA 207 GA23499-PA 1..169 1..168 485 50.9 Plus
Dpse\GA20450-PA 220 GA20450-PA 16..218 3..199 458 45.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22691-PA 201 GM22691-PA 1..201 1..201 1068 100 Plus
Dsec\GM15089-PA 205 GM15089-PA 8..184 5..183 551 58.3 Plus
Dsec\GM23016-PA 204 GM23016-PA 4..203 3..200 506 47.5 Plus
Dsec\GM15893-PA 207 GM15893-PA 1..191 1..189 493 48.2 Plus
Dsec\GM20500-PA 220 GM20500-PA 16..218 3..199 457 44.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15551-PA 201 GD15551-PA 1..201 1..201 1068 100 Plus
Dsim\GD19996-PA 205 GD19996-PA 8..184 5..183 551 58.3 Plus
Dsim\GD12244-PA 207 GD12244-PA 1..191 1..189 493 48.2 Plus
Dsim\GD18265-PA 213 GD18265-PA 1..196 1..196 436 44.6 Plus
Dsim\GD11278-PA 215 GD11278-PA 2..190 3..184 433 43.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19473-PA 201 GJ19473-PA 1..200 1..200 926 86.5 Plus
Dvir\GJ14443-PA 205 GJ14443-PA 4..184 1..183 551 57.6 Plus
Dvir\GJ15815-PA 204 GJ15815-PA 4..203 3..200 496 47 Plus
Dvir\GJ13999-PA 207 GJ13999-PA 1..169 1..168 484 50.9 Plus
Dvir\GJ20130-PA 220 GJ20130-PA 16..184 3..170 454 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16335-PA 200 GK16335-PA 1..199 1..200 942 89 Plus
Dwil\GK12772-PA 205 GK12772-PA 4..184 1..183 551 57.6 Plus
Dwil\GK25049-PA 204 GK25049-PA 4..203 3..200 504 47.5 Plus
Dwil\GK17214-PA 207 GK17214-PA 1..204 1..199 489 46.6 Plus
Dwil\GK19661-PA 220 GK19661-PA 16..218 3..199 456 44.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17342-PA 201 GE17342-PA 1..201 1..201 1063 99.5 Plus
Dyak\Rab1-PA 205 GE25003-PA 8..184 5..183 551 58.3 Plus
Dyak\GE17866-PA 204 GE17866-PA 4..203 3..200 506 47.5 Plus
Dyak\GE22459-PA 207 GE22459-PA 1..191 1..189 493 48.2 Plus
Dyak\GE13081-PA 220 GE13081-PA 16..218 3..199 457 44.2 Plus

LD21953.hyp Sequence

Translation from 891 to 1496

> LD21953.hyp
MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTV
DIEGMRVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVR
RWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMDIELFETS
AKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGGKCC
R*

LD21953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-PB 201 CG9575-PB 1..201 1..201 1046 100 Plus
Rab35-PD 201 CG9575-PD 1..201 1..201 1046 100 Plus
Rab35-PA 201 CG9575-PA 1..201 1..201 1046 100 Plus
Rab35-PC 190 CG9575-PC 8..190 19..201 953 100 Plus
Rab1-PA 205 CG3320-PA 8..184 5..183 531 58.3 Plus