Clone LD21956 Report

Search the DGRC for LD21956

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:219
Well:56
Vector:pOT2
Associated Gene/TranscriptPk17E-RA
Protein status:LD21956.pep: gold
Preliminary Size:2200
Sequenced Size:2054

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7001 2001-01-01 Release 2 assignment
CG7053 2001-01-01 Release 2 assignment
CG7001 2002-12-10 Blastp of sequenced clone
CG7001 2003-01-01 Sim4 clustering to Release 3
Pk17E 2008-04-29 Release 5.5 accounting
Pk17E 2008-08-15 Release 5.9 accounting
Pk17E 2008-12-18 5.12 accounting

Clone Sequence Records

LD21956.complete Sequence

2054 bp (2054 high quality bases) assembled on 2002-12-10

GenBank Submission: AY069491

> LD21956.complete
AAAAACAGCAAAATAGAGCCAGCCTTAGCTACCAAATATTTATATTAGAA
TTTCAGCTACCCCAACTGCGAGTGCGCGCTTTTTACTGCGATTTTTTGGC
TGCCCCTCACGCGCACGCACACGAACAGTGATTGCGCAATTCCAGTGGAA
CGAGTGGAGTGTGGTGGTGTGCGGTGTGTGTGTGTAAACAACAAGCGGAC
GACAAGGAAACAGAAACCGAAACAGAAACAACGGGAATTGATTGGGACGA
GTGGAGCTTTTGATGGGCAACTCGCAACCGCGTAATGCAAGCAGAAGCAG
AAGGACATCCCAGTGGCCACAAGGCGCAGCGGAACTAGGCGCCTCAGCCA
GCGATCACCACTACCACCAGGAGGAGCTGTATCAGGAGCAGCAGCAGCAG
CAACAACAGCCGCAACAGGAGCAACCGAGCAGCAGGAGAATCCAGTTCCA
GGCCCACACCAACCAGCCAACACAGTCGCATCCTCCGGGCGACGAGGAAC
AGCCTGTACAATCACAGCAGCAACAGCTTTCCACCTGGAGTCTTGGCAGC
CTTAGCGGAGGACGACTCAACTGGAGCTTCTCCGGTGCCCGCAACTCATT
TCGTCATCGAAACAAGGCCACGCGAAAGAGCTTGACCTCACTTCATGGCT
CTCGTCGTGGCAAGACTCAGTGGCACCGACCTCTGACCAACTCAATCTTC
AACTCGCACTTTAAGGAGACCAGCAAGAACGATCTGTACCGTATCGATCA
TTTGGTGGCCAAGGGAGCCTTTGGCGTGGTCTTCAAGGTGTCCAGCAAGA
GTGACATTAGTCAGTGCTACGCCCTGAAAGTGCTAAAGAAATCAAAGCTC
ATCGAAGACAACAGTGTACGGCAGATAAAGGACGAGGCGGACATTCAGAA
GGTTTGCGGCCATCATCCGTTTATCGTGAAGCAAATAGATCTGTGGCAAA
ACCGCCACAACCTCCATATTCTATCGGAGTACGTACCCAACGGCGAGTTG
TTCTCAAAAATAACTCACTTCTCCATTGATCTGGTTCGTTTATACATTGG
CGAGATAGCACTTGCCTTGGATTTTCTCCACAACGCTGGGATTATATATC
GTGATGCGAAGCCGGAGAACATCCTGCTAACTGAACAGTTTCACATAAAG
CTAACCGACTTCGGCCTTAGCAAGTGGCTCAAACTGGGGGCAAACACGCG
CACCATGTGTGGCACTTTCAAATACATGGCCCCGGAGATTCTGTGCGGGG
AACCCTATGGCCATGCGGTGGACTGGTGGGCCTTGGGCGTTATTGCCTGT
CAGATGCTGACGCAGAAGTCGCCCAACATCAAACGCCACCTACTGCGACG
GCGTGAGAGCGTGGAGCCGGAGGACGGCCTGTCCAATGCCCCATCCATTG
CTCAGATCAACGGCTGCCTGCAGGACAGTGACGGCGACAGCGAGGACTTC
CTGCCGGAGGAGGTGCAGCACCTCACCCACGAGGGCAGGGATGTGCTGCG
CAAGCTGCTCACCATTGAGCCGCGCCAGCGTATCCGCAGTGTGATGGCGC
TCCAAAGGATTGCCATCTACAAGGACTATAACCTGAGCTCCAAGCAGCTG
CTAAGTCTCTCGCCTCGGGAGATTATAGCCAGGGATGGAATCCGTATCTA
CGAGGACAGGCATTTCGACCAGCTGACCAATCAGTGTGCCATCGATGCTT
TCCTGGACTTCTAGCGCCCGAGCTGGAGGAGCCTTACAAACAACATCACA
TCGACTTGATGTTCAGCCATATTTTTTTCCACTTGTTTTGGTATTATTTA
AACTGCAACGTTCCATTCAACTAACAATTTGTACAAAAGTCTTATACTCT
CGACTCGATTAACAAATGCCTTTAAAATGAAGAAATAGTGTTTGCATTCT
TTACAATCGAACAAATAGCAAATTGTTTAAATATTATTAATAAATTATAT
TCCATATTATATATGCTATATTGAGCAAAAAAAAAATTCAAATGTATTCA
AAAAGCTTGCAGTGATAAATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

LD21956.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 2438 Pk17E-RA 289..2314 1..2026 10130 100 Plus
Pk17E.a 2300 Pk17E.a 157..2176 1..2026 10015 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18677669..18678200 1..520 2415 97.4 Plus
chrX 22417052 chrX 18694807..18695222 1607..2023 2020 99.5 Plus
chrX 22417052 chrX 18694458..18694747 1317..1606 1450 100 Plus
chrX 22417052 chrX 18679800..18680018 629..847 1080 99.5 Plus
chrX 22417052 chrX 18680425..18680584 1070..1229 800 100 Plus
chrX 22417052 chrX 18680081..18680206 846..971 615 99.2 Plus
chrX 22417052 chrX 18679628..18679740 518..630 565 100 Plus
chrX 22417052 chrX 18680271..18680369 972..1070 480 99 Plus
chrX 22417052 chrX 18682890..18682979 1229..1318 435 98.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 1452 CG7001-PA 1..1452 263..1714 7260 100 Plus
Pk17E-RC 1446 CG7001-PC 1..1446 263..1714 7135 99.6 Plus
Pk17E-RB 510 CG7001-PB 1..510 1205..1714 2550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 2129 CG7001-RA 107..2129 1..2023 10115 100 Plus
Pk17E-RC 2123 CG7001-RC 107..2123 1..2023 9990 99.7 Plus
Pk17E-RB 1651 CG7001-RB 145..1651 517..2023 7535 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-PA 483 CG7001-PA 1..483 263..1711 2318 100 Plus
Pk17E-PC 481 CG7001-PC 1..481 263..1711 2307 97.3 Plus
Pk17E-PB 169 CG7001-PB 1..169 1205..1711 889 100 Plus
S6k-PB 490 CG10539-PB 77..324 737..1540 387 36.7 Plus
S6k-PA 490 CG10539-PA 77..324 737..1540 387 36.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18788570..18789089 1..520 2600 100 Plus
X 23542271 X 18805641..18806060 1607..2026 2100 100 Plus
X 23542271 X 18805292..18805581 1317..1606 1450 100 Plus
X 23542271 X 18790675..18790893 629..847 1095 100 Plus
X 23542271 X 18791300..18791459 1070..1229 800 100 Plus
X 23542271 X 18790956..18791081 846..971 630 100 Plus
X 23542271 X 18790503..18790615 518..630 565 100 Plus
X 23542271 X 18791146..18791244 972..1070 495 100 Plus
X 23542271 X 18793758..18793847 1229..1318 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18796668..18797187 1..520 2600 100 Plus
X 23527363 X 18813739..18814158 1607..2026 2100 100 Plus
X 23527363 X 18813390..18813679 1317..1606 1450 100 Plus
X 23527363 X 18798773..18798991 629..847 1095 100 Plus
X 23527363 X 18799398..18799557 1070..1229 800 100 Plus
X 23527363 X 18799054..18799179 846..971 630 100 Plus
X 23527363 X 18798601..18798713 518..630 565 100 Plus
X 23527363 X 18799244..18799342 972..1070 495 100 Plus
X 23527363 X 18801856..18801945 1229..1318 450 100 Plus
Blast to na_te.dros performed 2014-11-26 23:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6887 393..550 202 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6996 316..525 198 60.6 Plus

LD21956.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:20:12 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18694807..18695222 1607..2023 93   Plus
chrX 18694460..18694747 1319..1606 100 -> Plus
chrX 18682891..18682979 1230..1318 98 -> Plus
chrX 18680426..18680584 1071..1229 100 -> Plus
chrX 18680271..18680369 972..1070 98 -> Plus
chrX 18680083..18680206 848..971 99 -> Plus
chrX 18679802..18680018 631..847 99 -> Plus
chrX 18679631..18679740 521..630 100 -> Plus
chrX 18678116..18678200 436..520 100 -> Plus
chrX 18677669..18678025 1..357 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:08:37 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 263..1714 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:01:40 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 263..1714 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:17:23 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 263..1714 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:52:06 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 263..1714 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:20:12 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 263..1714 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:08:36 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 105..2127 1..2023 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:01:40 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 105..2127 1..2023 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:17:23 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 107..2129 1..2023 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:52:07 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 105..2127 1..2023 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:20:12 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 107..2129 1..2023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:20:12 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
X 18805641..18806057 1607..2023 100   Plus
X 18805294..18805581 1319..1606 100 -> Plus
X 18793759..18793847 1230..1318 100 -> Plus
X 18791301..18791459 1071..1229 100 -> Plus
X 18791146..18791244 972..1070 100 -> Plus
X 18790958..18791081 848..971 100 -> Plus
X 18790677..18790893 631..847 100 -> Plus
X 18790506..18790615 521..630 100 -> Plus
X 18788570..18789089 1..520 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:17:23 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18699674..18700090 1607..2023 100   Plus
arm_X 18699327..18699614 1319..1606 100 -> Plus
arm_X 18687792..18687880 1230..1318 100 -> Plus
arm_X 18685334..18685492 1071..1229 100 -> Plus
arm_X 18685179..18685277 972..1070 100 -> Plus
arm_X 18684991..18685114 848..971 100 -> Plus
arm_X 18684710..18684926 631..847 100 -> Plus
arm_X 18684539..18684648 521..630 100 -> Plus
arm_X 18682603..18683122 1..520 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:24:03 Download gff for LD21956.complete
Subject Subject Range Query Range Percent Splice Strand
X 18813739..18814155 1607..2023 100   Plus
X 18813392..18813679 1319..1606 100 -> Plus
X 18801857..18801945 1230..1318 100 -> Plus
X 18799399..18799557 1071..1229 100 -> Plus
X 18799244..18799342 972..1070 100 -> Plus
X 18799056..18799179 848..971 100 -> Plus
X 18798775..18798991 631..847 100 -> Plus
X 18798604..18798713 521..630 100 -> Plus
X 18796668..18797187 1..520 100 -> Plus

LD21956.pep Sequence

Translation from 262 to 1713

> LD21956.pep
MGNSQPRNASRSRRTSQWPQGAAELGASASDHHYHQEELYQEQQQQQQQP
QQEQPSSRRIQFQAHTNQPTQSHPPGDEEQPVQSQQQQLSTWSLGSLSGG
RLNWSFSGARNSFRHRNKATRKSLTSLHGSRRGKTQWHRPLTNSIFNSHF
KETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDN
SVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKI
THFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDF
GLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLT
QKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEE
VQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLS
PREIIARDGIRIYEDRHFDQLTNQCAIDAFLDF*

LD21956.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19132-PA 475 GF19132-PA 1..475 1..483 1703 69.1 Plus
Dana\GF10442-PA 489 GF10442-PA 73..320 159..426 403 37.2 Plus
Dana\GF21004-PA 1280 GF21004-PA 563..805 159..424 386 35.4 Plus
Dana\GF12632-PA 606 GF12632-PA 257..462 151..354 378 38.5 Plus
Dana\GF21892-PA 495 GF21892-PA 116..382 77..354 374 34.7 Plus
Dana\GF21004-PA 1280 GF21004-PA 939..1191 159..423 209 24.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19184-PA 486 GG19184-PA 1..486 1..483 2248 94 Plus
Dere\GG14109-PA 491 GG14109-PA 77..324 159..426 402 37.2 Plus
Dere\GG19750-PA 914 GG19750-PA 202..444 159..424 381 35.1 Plus
Dere\GG22380-PA 606 GG22380-PA 257..462 151..354 377 38.5 Plus
Dere\GG24016-PA 485 GG24016-PA 112..372 83..354 374 35.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12172-PA 374 GH12172-PA 9..369 124..483 1331 69.5 Plus
Dgri\GH17036-PA 505 GH17036-PA 73..338 159..440 400 35.5 Plus
Dgri\GH20802-PA 607 GH20802-PA 247..463 140..354 377 37.4 Plus
Dgri\GH11053-PA 353 GH11053-PA 32..240 136..354 362 38.3 Plus
Dgri\GH18765-PA 525 GH18765-PA 185..381 164..358 359 39.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-PA 483 CG7001-PA 1..483 1..483 2544 100 Plus
Pk17E-PC 481 CG7001-PC 1..481 1..483 2521 99.6 Plus
Pk17E-PB 169 CG7001-PB 1..169 315..483 889 100 Plus
S6k-PB 490 CG10539-PB 77..324 159..426 387 36.7 Plus
S6k-PA 490 CG10539-PA 77..324 159..426 387 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12040-PA 495 GI12040-PA 73..338 159..440 410 36.6 Plus
Dmoj\GI14475-PA 1196 GI14475-PA 477..675 159..354 381 40.8 Plus
Dmoj\GI20886-PA 607 GI20886-PA 247..463 140..354 377 37.4 Plus
Dmoj\GI24186-PA 734 GI24186-PA 408..645 164..424 369 33.7 Plus
Dmoj\GI22655-PA 526 GI22655-PA 186..382 164..358 361 39.7 Plus
Dmoj\GI14475-PA 1196 GI14475-PA 848..1051 159..354 199 27.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26994-PA 552 GL26994-PA 152..552 90..483 1767 81.8 Plus
Dper\GL21416-PA 445 GL21416-PA 111..358 159..426 400 37.1 Plus
Dper\GL13301-PA 875 GL13301-PA 163..405 159..424 381 35.1 Plus
Dper\GL12220-PA 726 GL12220-PA 386..672 164..468 379 32.4 Plus
Dper\GL19216-PA 546 GL19216-PA 171..433 78..354 377 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22314-PA 416 GA22314-PA 148..410 90..352 1315 89.7 Plus
Dpse\GA10383-PA 487 GA10383-PA 73..320 159..426 403 37.2 Plus
Dpse\GA17848-PB 530 GA17848-PB 190..476 164..468 378 32.4 Plus
Dpse\GA30472-PC 500 GA30472-PC 151..356 151..354 377 38.5 Plus
Dpse\GA18145-PA 464 GA18145-PA 89..351 78..354 375 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22914-PA 484 GM22914-PA 1..484 1..483 2314 97.1 Plus
Dsec\GM13894-PA 490 GM13894-PA 77..324 159..426 403 37.2 Plus
Dsec\GM11736-PA 909 GM11736-PA 197..439 159..424 381 35.1 Plus
Dsec\GM20164-PA 954 GM20164-PA 605..810 151..354 380 38.5 Plus
Dsec\GM12352-PA 488 GM12352-PA 115..375 83..354 374 35.1 Plus
Dsec\GM11736-PA 909 GM11736-PA 566..770 159..354 192 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17406-PA 186 GD17406-PA 53..186 350..483 628 96.3 Plus
Dsim\GD13174-PA 517 GD13174-PA 77..324 159..426 405 37.2 Plus
Dsim\GD17550-PA 909 GD17550-PA 197..439 159..424 381 35.1 Plus
Dsim\GD25642-PA 580 GD25642-PA 257..462 151..354 376 38.5 Plus
Dsim\GD19074-PA 530 GD19074-PA 190..426 164..424 369 34.7 Plus
Dsim\GD17550-PA 909 GD17550-PA 566..770 159..354 192 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13310-PA 496 GJ13310-PA 73..338 159..440 405 36.2 Plus
Dvir\GJ18812-PA 1257 GJ18812-PA 537..735 159..354 382 40.8 Plus
Dvir\GJ20621-PA 607 GJ20621-PA 247..463 140..354 379 37.9 Plus
Dvir\GJ17913-PA 476 GJ17913-PA 91..363 78..354 377 35.1 Plus
Dvir\GJ23383-PA 526 GJ23383-PA 186..382 164..358 363 39.7 Plus
Dvir\GJ18812-PA 1257 GJ18812-PA 909..1112 159..354 192 26.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10197-PA 486 GK10197-PA 68..486 89..483 1645 76.4 Plus
Dwil\GK17534-PA 482 GK17534-PA 73..338 159..440 405 36.3 Plus
Dwil\GK25774-PA 894 GK25774-PA 164..406 159..424 385 35.8 Plus
Dwil\GK21803-PA 605 GK21803-PA 263..461 159..354 374 38.5 Plus
Dwil\GK13262-PA 531 GK13262-PA 191..383 164..354 372 41.5 Plus
Dwil\GK25774-PA 894 GK25774-PA 599..754 207..354 187 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Pk17E-PA 491 GE17748-PA 1..491 1..483 2214 93.3 Plus
Dyak\GE20533-PA 491 GE20533-PA 77..324 159..426 403 37.2 Plus
Dyak\S6kII-PA 909 GE17944-PA 153..439 129..424 385 34 Plus
Dyak\GE12269-PA 604 GE12269-PA 255..460 151..354 377 38.5 Plus
Dyak\Pka-C1-PA 488 GE10413-PA 115..375 83..354 374 35.1 Plus
Dyak\S6kII-PA 909 GE17944-PA 566..770 159..354 192 26.2 Plus

LD21956.hyp Sequence

Translation from 262 to 1713

> LD21956.hyp
MGNSQPRNASRSRRTSQWPQGAAELGASASDHHYHQEELYQEQQQQQQQP
QQEQPSSRRIQFQAHTNQPTQSHPPGDEEQPVQSQQQQLSTWSLGSLSGG
RLNWSFSGARNSFRHRNKATRKSLTSLHGSRRGKTQWHRPLTNSIFNSHF
KETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDN
SVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKI
THFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDF
GLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLT
QKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEE
VQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLS
PREIIARDGIRIYEDRHFDQLTNQCAIDAFLDF*

LD21956.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-PA 483 CG7001-PA 1..483 1..483 2544 100 Plus
Pk17E-PC 481 CG7001-PC 1..481 1..483 2521 99.6 Plus
Pk17E-PB 169 CG7001-PB 1..169 315..483 889 100 Plus
S6k-PB 490 CG10539-PB 77..324 159..426 387 36.7 Plus
S6k-PA 490 CG10539-PA 77..324 159..426 387 36.7 Plus