Clone LD22457 Report

Search the DGRC for LD22457

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:224
Well:57
Vector:pOT2
Associated Gene/TranscriptEhbp1-RG
Protein status:LD22457.pep: gold
Sequenced Size:3805

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15609-RE 2009-06-22 Replacement based on scoring

Clone Sequence Records

LD22457.complete Sequence

3805 bp assembled on 2009-08-31

GenBank Submission: BT099671.1

> LD22457.complete
AAAAAATCGGATCGAAGTGTAAATCGGTGTGAATTAAATTATTCGCTGTG
ATGTGATAAAAGCTAAACGGCAGCGAGTGCTCGTAATAAACGCGCAAATG
TTCGGCGTAGTGTCCCCAAATCGAAGGACCTTGAAACGAAATTGGAGACC
AAAACAAAAGTGACGTCATAATGGTGCTATTTATGTATTTATCGCCTGCA
GAAGTTAGCTGGTAAAAATGACACAATAGATTACTGAAAAAGCAAAGCAA
CGACGATCCAAACGGGTCTAATTTTTATACAAACCCCAACACCCCCAAAG
ATATCCAAATTAAAGAGCCCTACGATCCACACCCGCTAAGATGGCCAGCG
TATGGAAGCGATTGCAGCGCAATTTCAAGCGAGCCGCCAAATTCCAGTTC
ACCGCATCGTACCACGATCTGCATCTGGAAACCACCGCCAAGTGGCGGCC
GTCGAACCTCTCTATCGTTTGGACCAGAAGATCTAGACGAGTGGCCAGTG
CTCCTTTGCCATGGGAGCCGGACATGATGAACCCCTTGGTGGGCAATATA
TCCTGGCCAGTGCCCGACAATCACACCATATCCGTCACCCTGTTTAAGGA
TCCTCGGACACACGAGCTGGAGGACAAGGACTGGACGTTTGTCATCGAAG
ATGTCACTCCAATGGGCAAGAAACGTGTGCTGGCCAATGCCAGCATTAAT
ATGAGGAAGTATGCCAGCATAGAATCCACTCAGCAGAGCTTTACCTTGAG
CCTAAAGCCAGTCTCGAAGAAGATTACTGCAGCCAGTTTGGAGCTCACGA
TTAGCTGTGTATTTTTGCGAGAAGGAAAGGCTACAGACGAGGACATGCAG
AGCGTTGTCTCCATGATGTCCGTGAACAACAATGATGTGGCGCCTTTGGA
TGACTTGGAGGATATTCCAGATCTTGATGGCTTTAGTGAAATTACGGACA
ATTTTAATGACTTTACACAGCAACTGGAGCATATGACAACTAGCCTAAAT
GGCTGCATTGATGTGGCCACGCCTCAAAGTGACGCCGACGGCAAGCGGGA
AGCTGCTAACAAGTTAGACTTGCCCACAGCTGCATCCGGTGGTTCTAGTG
GTGCTGAAGAGTCCCTGAAAACGCCGAATGGATTGCAGCATGTGGTGGAC
CAAACGCCAATAAAGTCACCAGATGAAGTAAAGCAGCCAAAGCAGACGCC
GGTGGAGTCATTGAGGTCCAAAACTAACGAGGACTTTGACAAAATGGTCA
CCTCAACGCCACTCGAACCCAACGTAAACAAGGATGATGTGAAGCCAAAG
AAGAAGAGGGCTTTATTCTTCACTGAGAAGGAGGATGAGCAGGACTTAAG
GGTGGAAAGTGTGAAGGAGGATACCACCAAGACTATCGGCGACAACAGCA
CCACTAAGGAAAAGCCCAAAGAAGAAAGCCAATCCAGTAAGGATGCCTCA
TCCGTGGTGGTTCCGAGTGCCAAGCGCCCTGAACTGCAGCCCCTAAATCT
AAAGAAGAGTTACGAACCCTCGCAGACACCTGAATCCGCACCCGTACCCG
CATCTGTGATAAACGAATCGATTGGATCGTGCTTTAGTACGTCTGGCTCG
TTGAACAACAGCCTTAAGCCGGTGGAGAAGATCGTGCTGAAGGAGAACAC
GCCCGGGCAGGATCTGCTGGAGTGGTGCAAAGAAGTTACCAAAGACTACC
CCAATGTTAAGGTTACCAACCTGACGACCAGCTGGCGCAACGGCATGGCC
TTCTGCGCTATTATTCATCATTTTGTGCCGGAGCTCATTGACATGTCTAA
GCTGAGCGCCCATGACGTAGTTGGCAATTGTCGAATTGGCTTCGATGCGG
CGGAATCATTAGGAATACCTCGTGTAATCGAGCCGCGCGACATGAATATG
CTCACGGTACCGGACAAGTTGGCCGTGATGACCTATTTGCATCAGTTGCG
GGCGCACTTTACCGGCAAGCAGCTAAAAATTGAGCAAATCGGTTCAACGG
CAGACGAGTCGAGCTACGTTATTGGAGACTACAAGTCGGACAATTTGTCG
CAGAATCGCATTAACTTTTCGCACCCCAAGTCGTTGTTGCTGCATCAAAA
CTCATTCGATGAGGAGATAAATGGTTCAAATAAATCGGAGCAACTTTCAC
CCACAAGCAAAAAGGATGTGAAGAATTTGATTCTGTACAACTCGAAGAAT
ATTCTGGACAAGGTGCTGTCGCCCACCAAGGACAAGAACTCGATCAACGC
ATCGCAGCATGCAAATCAATCGCCGATGTTGAGCTGCCAGACAACACCGC
CGCAGGATGAATCACTGGATAAAGGGTCACAACCGGGTGGCAAGGAGAAC
AGCTCCATAACCACCATTGATCCGCAGGCGGCCAGTCGAATTTTAACGCG
CCACAAGATGATGAGCGAAAAAGCCAAGCTGATGATGGAAAAGCGAAAGC
TTAACAAAACCAGCGACGCGAACGACGAGGAGAGGCAGCAGCGTCTGCTG
GAACAGGCTCGTCGCCTTATCCTGGAGACTCGTGTGAAGAGCGGTGGTTC
CATCGAGAGTCCCACCAGGCCCAAGCTGGAGCGCACCATCTCGCCGATCC
ACAACGGAGCCGAGGAATTCTATGCGGAGCACGCGAAAAAGCTGGAGCTT
AAGGAGCCAGGCAGTCCTAGTCATAGGTTAAGTGATCCGAAGGTCCTACA
GTCCTTCAACGCAATCGTGGAGCGCGTCTCACCAAAGCACGAGAAGAGGG
GTGACAAGCTGTCCTACATCGATTCCGAGCTGGAGGCCCTGGAGCGGGAG
CAGGAGGCTATCGACCAGAAGGCCAGCAATCTGGAGGCCAAGCTGCGCGC
CGTAATGGGCGGCAATCCAAAGACCGAGGAGACAGAGGAGCAACTGCTAT
CGCAATGGTTTACGCTGGTCAACAAGAAGAACGCACTCCTCCGGCGACAG
ATGCAGCTAAATATACTCGAGCAAGAAAAAGATTTGGAGCGAAAATATAC
AATGCTTAATCAAGAGCTGCGGGCGGCGCAATCTGTGGAAGATTGGCGCA
AAACGGAAGTTCAGCGTGAAAAGGAGCGACTGCTGCTCGAGGAACTGATG
ACGATTGTCGACAAGCGCGACCAGTTGGTTCAGCACTTGCACAACCAAGA
GATAGCGATCGAAGACGACCAGGAGATCGCGAGGAAACTGGAGCACGTGG
ACATCAGTGCTGAAAAAGACAAATGTGTTCTTCAATAGAAATCGAAATTA
ACCAAACCTGACTGGAGATTATACTTACACACACTCAATCTTATCTATGT
AACTAGTTAGATAACAACTATGTTCAGAGACACGCGATAAGGTCGCGTGG
TTTTTGTGGTTCGGTGTCGCTTCTTATGCAATCGTTATATCCAACGACAA
CAAATACTTGGACCACTTGGTATGGTTATTAAAAAAAAAAAGGTATACTG
TGAAACAAAACAAATTGCTTTTGTATTTAAGCAAAACAATTCAAGAAATA
AGAACAAAACGTCCGTTAGTGAACTAAGTAAAAAGACAGGCACACGTTTA
TACACCTATTTACGATAATCAGATCTTGGTATTACTTTAAATTAAATGGT
GGTAACTTTGTTTCATGTTTCGTTGTTGTGCCATCTGAACCACTCCTAAC
TTATGTAAATCCTGAACGCAATAGCGATGTGAGATAGGGAATTGAGGAGG
CAATTTTACGTTAGTTTTACTTTAGCATTTATCCCACATAACTAGAAACG
CTTCATCCAAAAATACACGTACACTTATATATTTATGAAAAAAAAAAAAA
AAAAA

LD22457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15609-RG 4074 CG15609-RG 43..3831 1..3789 18945 100 Plus
CG15609.b 4516 CG15609.b 1203..3042 1031..2870 9200 100 Plus
CG15609.f 4773 CG15609.f 1195..3034 1031..2870 9200 100 Plus
CG15609.b 4516 CG15609.b 3595..4513 2871..3789 4595 100 Plus
CG15609.f 4773 CG15609.f 3587..4505 2871..3789 4595 100 Plus
CG15609.b 4516 CG15609.b 43..876 1..834 4170 100 Plus
CG15609.f 4773 CG15609.f 35..868 1..834 4170 100 Plus
CG15609.b 4516 CG15609.b 941..1137 835..1031 985 100 Plus
CG15609.f 4773 CG15609.f 933..1129 835..1031 985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12899172..12899929 1788..1031 3760 99.7 Minus
chr2R 21145070 chr2R 12895125..12895755 3787..3157 3155 100 Minus
chr2R 21145070 chr2R 12898373..12898768 2386..1991 1980 100 Minus
chr2R 21145070 chr2R 12897481..12897754 2750..2477 1370 100 Minus
chr2R 21145070 chr2R 12902166..12902420 445..191 1275 100 Minus
chr2R 21145070 chr2R 12901005..12901215 654..444 1040 99.5 Minus
chr2R 21145070 chr2R 12898832..12899036 1993..1789 1025 100 Minus
chr2R 21145070 chr2R 12900503..12900699 1031..835 955 99 Minus
chr2R 21145070 chr2R 12895815..12896004 3157..2968 950 100 Minus
chr2R 21145070 chr2R 12902881..12903070 190..1 950 100 Minus
chr2R 21145070 chr2R 12900764..12900945 834..653 910 100 Minus
chr2R 21145070 chr2R 12897272..12897393 2870..2749 610 100 Minus
chr2R 21145070 chr2R 12896065..12896161 2967..2871 485 100 Minus
chr2R 21145070 chr2R 12898105..12898195 2477..2387 455 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-RG 2898 CG15609-PG 1..2898 341..3238 14490 100 Plus
Ehbp1-RB 2964 CG15609-PB 757..2964 1031..3238 11040 100 Plus
Ehbp1-RI 2985 CG15609-PI 757..2985 1031..3238 10795 99.1 Plus
Ehbp1-RB 2964 CG15609-PB 1..691 341..1031 3455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:11:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-RG 3829 CG15609-RG 43..3829 1..3787 18935 100 Plus
Ehbp1-RB 3864 CG15609-RB 1108..3864 1031..3787 13785 100 Plus
Ehbp1-RI 4152 CG15609-RI 1143..3920 1031..3787 13540 99.2 Plus
Ehbp1-RB 3864 CG15609-RB 202..1042 191..1031 4205 100 Plus
Ehbp1-RB 3864 CG15609-RB 43..201 1..159 795 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-PG 965 CG15609-PG 1..965 341..3235 4409 100 Plus
Ehbp1-PB 987 CG15609-PB 1..987 341..3235 4376 97.8 Plus
Ehbp1-PI 994 CG15609-PI 1..994 341..3235 4358 97.1 Plus
Ehbp1-PF 1141 CG15609-PF 1..835 341..2869 3660 92.3 Plus
Ehbp1-PF 1141 CG15609-PF 991..1141 2786..3235 546 83.4 Plus
MICAL-like-PA 1010 CG11259-PA 8..259 1640..2377 277 31 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17011952..17012709 1788..1031 3790 100 Minus
2R 25286936 2R 17007904..17008536 3789..3157 3165 100 Minus
2R 25286936 2R 17011154..17011549 2386..1991 1980 100 Minus
2R 25286936 2R 17010262..17010535 2750..2477 1370 100 Minus
2R 25286936 2R 17014948..17015202 445..191 1275 100 Minus
2R 25286936 2R 17013787..17013997 654..444 1055 100 Minus
2R 25286936 2R 17011612..17011816 1993..1789 1025 100 Minus
2R 25286936 2R 17013285..17013481 1031..835 985 100 Minus
2R 25286936 2R 17008596..17008785 3157..2968 950 100 Minus
2R 25286936 2R 17015663..17015852 190..1 950 100 Minus
2R 25286936 2R 17013546..17013727 834..653 910 100 Minus
2R 25286936 2R 17010053..17010174 2870..2749 610 100 Minus
2R 25286936 2R 17008846..17008942 2967..2871 485 100 Minus
2R 25286936 2R 17010886..17010976 2477..2387 455 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17013151..17013908 1788..1031 3790 100 Minus
2R 25260384 2R 17009103..17009735 3789..3157 3165 100 Minus
2R 25260384 2R 17012353..17012748 2386..1991 1980 100 Minus
2R 25260384 2R 17011461..17011734 2750..2477 1370 100 Minus
2R 25260384 2R 17016147..17016401 445..191 1275 100 Minus
2R 25260384 2R 17014986..17015196 654..444 1055 100 Minus
2R 25260384 2R 17012811..17013015 1993..1789 1025 100 Minus
2R 25260384 2R 17014484..17014680 1031..835 985 100 Minus
2R 25260384 2R 17016862..17017051 190..1 950 100 Minus
2R 25260384 2R 17009795..17009984 3157..2968 950 100 Minus
2R 25260384 2R 17014745..17014926 834..653 910 100 Minus
2R 25260384 2R 17011252..17011373 2870..2749 610 100 Minus
2R 25260384 2R 17010045..17010141 2967..2871 485 100 Minus
2R 25260384 2R 17012085..17012175 2477..2387 455 100 Minus
Blast to na_te.dros performed 2014-11-26 20:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
micropia 5461 micropia DMDM11 5461bp 339..375 1178..1214 122 81.1 Plus
micropia 5461 micropia DMDM11 5461bp 5324..5360 1178..1214 122 81.1 Plus
transib3 2883 transib3 TRANSIB3 2883bp 982..1014 3462..3494 120 84.8 Plus

LD22457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:44:15 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12902881..12903070 1..190 100   Minus
chr2R 12902167..12902420 191..444 100 <- Minus
chr2R 12901007..12901214 445..652 99 <- Minus
chr2R 12900764..12900945 653..834 100 <- Minus
chr2R 12900503..12900699 835..1031 98 <- Minus
chr2R 12899172..12899928 1032..1788 99 <- Minus
chr2R 12898834..12899036 1789..1991 100 <- Minus
chr2R 12898373..12898767 1992..2386 100 <- Minus
chr2R 12898106..12898195 2387..2476 100 <- Minus
chr2R 12897482..12897754 2477..2749 100 <- Minus
chr2R 12897272..12897392 2750..2870 100 <- Minus
chr2R 12896065..12896161 2871..2967 100 <- Minus
chr2R 12895816..12896004 2968..3156 100 <- Minus
chr2R 12895125..12895755 3157..3787 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:10 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
CG15609-RG 1..2898 341..3238 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:10:54 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
CG15609-RG 1..2898 341..3238 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:45 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 1..2898 341..3238 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:15 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 1..2898 341..3238 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-31 21:03:41 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
CG15609-RG 35..3821 1..3787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:10:54 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
CG15609-RG 35..3821 1..3787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:45 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 43..3829 1..3787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:15 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 43..3829 1..3787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:44:15 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17015663..17015852 1..190 100   Minus
2R 17014949..17015202 191..444 100 <- Minus
2R 17013789..17013996 445..652 100 <- Minus
2R 17013546..17013727 653..834 100 <- Minus
2R 17013285..17013481 835..1031 100 <- Minus
2R 17011952..17012708 1032..1788 100 <- Minus
2R 17011614..17011816 1789..1991 100 <- Minus
2R 17011154..17011548 1992..2386 100 <- Minus
2R 17010887..17010976 2387..2476 100 <- Minus
2R 17010263..17010535 2477..2749 100 <- Minus
2R 17010053..17010173 2750..2870 100 <- Minus
2R 17008846..17008942 2871..2967 100 <- Minus
2R 17008597..17008785 2968..3156 100 <- Minus
2R 17007906..17008536 3157..3787 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:45 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12903168..12903357 1..190 100   Minus
arm_2R 12902454..12902707 191..444 100 <- Minus
arm_2R 12901294..12901501 445..652 100 <- Minus
arm_2R 12901051..12901232 653..834 100 <- Minus
arm_2R 12900790..12900986 835..1031 100 <- Minus
arm_2R 12899457..12900213 1032..1788 100 <- Minus
arm_2R 12899119..12899321 1789..1991 100 <- Minus
arm_2R 12898659..12899053 1992..2386 100 <- Minus
arm_2R 12898392..12898481 2387..2476 100 <- Minus
arm_2R 12897768..12898040 2477..2749 100 <- Minus
arm_2R 12897558..12897678 2750..2870 100 <- Minus
arm_2R 12896351..12896447 2871..2967 100 <- Minus
arm_2R 12896102..12896290 2968..3156 100 <- Minus
arm_2R 12895411..12896041 3157..3787 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:02:16 Download gff for LD22457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17016862..17017051 1..190 100   Minus
2R 17016148..17016401 191..444 100 <- Minus
2R 17014988..17015195 445..652 100 <- Minus
2R 17014745..17014926 653..834 100 <- Minus
2R 17014484..17014680 835..1031 100 <- Minus
2R 17013151..17013907 1032..1788 100 <- Minus
2R 17012813..17013015 1789..1991 100 <- Minus
2R 17012353..17012747 1992..2386 100 <- Minus
2R 17012086..17012175 2387..2476 100 <- Minus
2R 17011462..17011734 2477..2749 100 <- Minus
2R 17011252..17011372 2750..2870 100 <- Minus
2R 17010045..17010141 2871..2967 100 <- Minus
2R 17009796..17009984 2968..3156 100 <- Minus
2R 17009105..17009735 3157..3787 100 <- Minus

LD22457.pep Sequence

Translation from 340 to 3237

> LD22457.pep
MASVWKRLQRNFKRAAKFQFTASYHDLHLETTAKWRPSNLSIVWTRRSRR
VASAPLPWEPDMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTF
VIEDVTPMGKKRVLANASINMRKYASIESTQQSFTLSLKPVSKKITAASL
ELTISCVFLREGKATDEDMQSVVSMMSVNNNDVAPLDDLEDIPDLDGFSE
ITDNFNDFTQQLEHMTTSLNGCIDVATPQSDADGKREAANKLDLPTAASG
GSSGAEESLKTPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFD
KMVTSTPLEPNVNKDDVKPKKKRALFFTEKEDEQDLRVESVKEDTTKTIG
DNSTTKEKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPESA
PVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKENTPGQDLLEWCKEVT
KDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIG
FDAAESLGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKIEQI
GSTADESSYVIGDYKSDNLSQNRINFSHPKSLLLHQNSFDEEINGSNKSE
QLSPTSKKDVKNLILYNSKNILDKVLSPTKDKNSINASQHANQSPMLSCQ
TTPPQDESLDKGSQPGGKENSSITTIDPQAASRILTRHKMMSEKAKLMME
KRKLNKTSDANDEERQQRLLEQARRLILETRVKSGGSIESPTRPKLERTI
SPIHNGAEEFYAEHAKKLELKEPGSPSHRLSDPKVLQSFNAIVERVSPKH
EKRGDKLSYIDSELEALEREQEAIDQKASNLEAKLRAVMGGNPKTEETEE
QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVE
DWRKTEVQREKERLLLEELMTIVDKRDQLVQHLHNQEIAIEDDQEIARKL
EHVDISAEKDKCVLQ*

LD22457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13432-PA 994 GF13432-PA 1..994 1..965 3866 77.9 Plus
Dana\GF21987-PA 921 GF21987-PA 112..256 410..544 242 37.9 Plus
Dana\GF22264-PA 289 GF22264-PA 186..289 442..544 231 38.5 Plus
Dana\GF22063-PA 1120 GF22063-PA 1020..1118 442..540 231 38.4 Plus
Dana\GF21115-PA 2291 GF21115-PA 127..304 409..565 222 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22226-PA 1173 GG22226-PA 1..865 1..843 4255 94.2 Plus
Dere\GG22226-PA 1173 GG22226-PA 1059..1173 851..965 537 100 Plus
Dere\GG13789-PA 1014 GG13789-PA 7..120 433..546 299 49.6 Plus
Dere\GG12661-PA 921 GG12661-PA 112..256 410..544 242 37.9 Plus
Dere\GG12754-PA 1105 GG12754-PA 1005..1103 442..540 228 37.4 Plus
Dere\GG19595-PA 2532 GG19595-PA 2429..2528 442..540 226 37 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22635-PA 1009 GH22635-PA 1..1009 1..965 3121 66.1 Plus
Dgri\GH11854-PA 884 GH11854-PA 6..112 439..543 269 46.7 Plus
Dgri\GH24410-PA 921 GH24410-PA 112..256 410..544 241 37.9 Plus
Dgri\GH24633-PA 987 GH24633-PA 844..985 394..540 229 33.1 Plus
Dgri\GH12687-PA 288 GH12687-PA 185..288 442..544 223 36.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-PG 965 CG15609-PG 1..965 1..965 4942 100 Plus
Ehbp1-PB 987 CG15609-PB 1..987 1..965 4909 97.8 Plus
Ehbp1-PI 994 CG15609-PI 1..994 1..965 4891 97.1 Plus
Ehbp1-PF 1141 CG15609-PF 1..835 1..843 4108 94 Plus
Ehbp1-PF 1141 CG15609-PF 991..1141 816..965 608 83.4 Plus
MICAL-like-PA 1010 CG11259-PA 8..448 434..881 278 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18329-PA 1009 GI18329-PA 1..1009 1..965 3084 65.1 Plus
Dmoj\GI15429-PA 921 GI15429-PA 112..256 410..544 241 37.9 Plus
Dmoj\GI15822-PA 1142 GI15822-PA 990..1140 395..540 240 32.9 Plus
Dmoj\GI16361-PA 289 GI16361-PA 186..289 442..544 225 36.5 Plus
Dmoj\GI16305-PA 2292 GI16305-PA 127..304 409..565 219 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11610-PA 1211 GL11610-PA 1..897 1..848 3202 71.1 Plus
Dper\GL11610-PA 1211 GL11610-PA 1097..1211 851..965 498 93 Plus
Dper\GL15130-PA 558 GL15130-PA 112..256 410..544 240 37.9 Plus
Dper\GL21395-PA 1156 GL21395-PA 1056..1154 442..540 235 39.4 Plus
Dper\GL14303-PA 573 GL14303-PA 470..573 442..544 227 36.5 Plus
Dper\GL15987-PA 2250 GL15987-PA 127..304 409..565 223 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13844-PB 1018 GA13844-PB 1..1018 1..965 3745 74.1 Plus
Dpse\GA13844-PE 984 GA13844-PE 1..984 1..965 3601 72.1 Plus
Dpse\GA13844-PA 1215 GA13844-PA 1..901 1..848 3208 71.2 Plus
Dpse\GA13844-PC 1047 GA13844-PC 1..733 169..848 2294 65.2 Plus
Dpse\GA13844-PC 1047 GA13844-PC 933..1047 851..965 500 93 Plus
Dpse\GA13844-PA 1215 GA13844-PA 1101..1215 851..965 498 93 Plus
Dpse\GA18143-PA 921 GA18143-PA 112..256 410..544 242 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20013-PA 1173 GM20013-PA 1..865 1..843 4346 96.1 Plus
Dsec\GM20013-PA 1173 GM20013-PA 1059..1173 851..965 537 100 Plus
Dsec\GM24615-PA 1010 GM24615-PA 12..120 439..546 296 51.8 Plus
Dsec\GM18928-PA 311 GM18928-PA 112..290 410..576 237 33.3 Plus
Dsec\GM19034-PA 1098 GM19034-PA 998..1096 442..540 228 37.4 Plus
Dsec\GM12499-PA 229 GM12499-PA 126..229 442..544 217 36.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25502-PA 1173 GD25502-PA 1..865 1..843 4423 96.3 Plus
Dsim\GD25502-PA 1173 GD25502-PA 1059..1173 851..965 537 100 Plus
Dsim\GD12682-PA 913 GD12682-PA 12..120 439..546 297 51.8 Plus
Dsim\GD16472-PA 1103 GD16472-PA 1003..1101 442..540 227 37.4 Plus
Dsim\GD16804-PA 2502 GD16804-PA 2399..2498 442..540 226 37 Plus
Dsim\GD15677-PA 1205 GD15677-PA 127..304 409..565 218 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19754-PA 1004 GJ19754-PA 1..1004 1..965 3288 68.2 Plus
Dvir\GJ16390-PA 895 GJ16390-PA 112..256 410..544 242 37.9 Plus
Dvir\GJ18675-PA 1070 GJ18675-PA 925..1068 396..540 233 33.1 Plus
Dvir\GJ15641-PA 2291 GJ15641-PA 127..332 409..595 220 29.9 Plus
Dvir\GJ16730-PA 298 GJ16730-PA 198..298 445..544 194 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21916-PA 1007 GK21916-PA 1..1007 1..965 3253 67 Plus
Dwil\GK17790-PA 1103 GK17790-PA 10..113 442..544 258 45.2 Plus
Dwil\GK25747-PA 943 GK25747-PA 112..307 410..600 253 31.9 Plus
Dwil\GK16173-PA 1126 GK16173-PA 970..1124 370..540 224 29.2 Plus
Dwil\GK20142-PA 289 GK20142-PA 186..289 442..544 221 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14223-PA 1172 GE14223-PA 1..864 1..843 4197 93.3 Plus
Dyak\GE14223-PA 1172 GE14223-PA 1058..1172 851..965 537 100 Plus
Dyak\GE20082-PA 1015 GE20082-PA 7..120 433..546 298 49.6 Plus
Dyak\GE16579-PA 952 GE16579-PA 852..950 442..540 227 37.4 Plus
Dyak\GE16755-PA 3168 GE16755-PA 3065..3164 442..540 226 37 Plus
Dyak\GE17676-PA 2289 GE17676-PA 127..304 409..565 220 32 Plus

LD22457.hyp Sequence

Translation from 340 to 3237

> LD22457.hyp
MASVWKRLQRNFKRAAKFQFTASYHDLHLETTAKWRPSNLSIVWTRRSRR
VASAPLPWEPDMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTF
VIEDVTPMGKKRVLANASINMRKYASIESTQQSFTLSLKPVSKKITAASL
ELTISCVFLREGKATDEDMQSVVSMMSVNNNDVAPLDDLEDIPDLDGFSE
ITDNFNDFTQQLEHMTTSLNGCIDVATPQSDADGKREAANKLDLPTAASG
GSSGAEESLKTPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFD
KMVTSTPLEPNVNKDDVKPKKKRALFFTEKEDEQDLRVESVKEDTTKTIG
DNSTTKEKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPESA
PVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKENTPGQDLLEWCKEVT
KDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIG
FDAAESLGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKIEQI
GSTADESSYVIGDYKSDNLSQNRINFSHPKSLLLHQNSFDEEINGSNKSE
QLSPTSKKDVKNLILYNSKNILDKVLSPTKDKNSINASQHANQSPMLSCQ
TTPPQDESLDKGSQPGGKENSSITTIDPQAASRILTRHKMMSEKAKLMME
KRKLNKTSDANDEERQQRLLEQARRLILETRVKSGGSIESPTRPKLERTI
SPIHNGAEEFYAEHAKKLELKEPGSPSHRLSDPKVLQSFNAIVERVSPKH
EKRGDKLSYIDSELEALEREQEAIDQKASNLEAKLRAVMGGNPKTEETEE
QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVE
DWRKTEVQREKERLLLEELMTIVDKRDQLVQHLHNQEIAIEDDQEIARKL
EHVDISAEKDKCVLQ*

LD22457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-PG 965 CG15609-PG 1..965 1..965 4942 100 Plus
Ehbp1-PB 987 CG15609-PB 1..987 1..965 4909 97.8 Plus
Ehbp1-PI 994 CG15609-PI 1..994 1..965 4891 97.1 Plus
Ehbp1-PF 1141 CG15609-PF 1..835 1..843 4108 94 Plus
Ehbp1-PF 1141 CG15609-PF 991..1141 816..965 608 83.4 Plus
MICAL-like-PA 1010 CG11259-PA 8..448 434..881 278 25.6 Plus