Clone LD23570 Report

Search the DGRC for LD23570

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:235
Well:70
Vector:pOT2
Associated Gene/TranscriptCG11596-RC
Protein status:LD23570.pep: gold
Sequenced Size:1778

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11596-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LD23570.complete Sequence

1778 bp assembled on 2010-11-23

GenBank Submission: BT125784.1

> LD23570.complete
CAAAGGCAACGGATTACTCCCAGGATTTAAATAGCATAGATTATCGTTGA
AACCGCTGACGACGCGCCCAGATGAGCTCCATGGACTGCGCCACGTTCCC
AATGCATCCTAAAATGGACGAGCAACTGGCCCGAACCTTCGTCATCAACG
AGGAGGAGGAGGAGAAGCACATTCAGAAGGTGCAGAACGCCTTCCTTTAC
TATGGGCCATATGCGTGTCAGCGGCTAAAGCGCTCCATGGATTACCTGAA
CAGCCTGTCTGGCGAGGACCAAATCATGCTAGCCAAGTACCGAGGGCATC
TGGAGTGCGTGCGCACGTGCATCGATCGCAACCAGGCGGTTATCCGGGAA
ATATTGCGCGGGCGTGTCCTCTATCCGACGGATGAGGCGACTGGTGATCC
CTCGGAGTTTGACGAGCCGCCGCCAAATGTGCGGCACGGTGACATGGACC
AGATTGATATTCCATTCGATGAAGCTGACGTTGAACCTCTAAAAATTTTA
AAGGCCCAGTCGACGTTGAAGTTGATTGCGCGCGACTGGAGCACTGAAGG
AGCCTTAGAACGGGAGCAATCGTATAAACCGATCATCGACAGCATCGTTG
CGTACTTCAAGCACAGCGATTTCGAGCTGAAGGATATAAAGATCCTAGTG
CCGGGAGCGGGGTTGGGACGGCTCACCTACGAGCTTGCCTGCTTGGGGTA
CTCGTGCGAGGGCAACGAGTTTTCCTACTTCATGCTGATCGCCTCCAATT
TTGTCCTCAACCTCTGCGACAACGAGAACAAGTACGTGTTATATCCGTGG
GTGCACCAGTATGTGAATAACTTAAGGCGTGAGGATCAGGTGGCCCCCGT
TCGTTTCCCAGACGTCTGCCCGCTTAAAAATCCACCCAAGGGCCATTTTG
AAATAGCAGCTGGCGACTTTCTGGAGGTCTACAAGACGCCGAACGCCTAC
AACTGCGTGGCTACGTGCTTCTTCATCGATTGTGCCAATAATGTTATTGA
CTTCATACGCACAATTTACAAAATCCTCGTGCCTGGTGGCATTTGGGTGA
ATCTCGGGCCGCTGCTGTACCATTTTAGCGACGTCAGCGGGCAAAACAGC
ATCGAGCCGGCTTTCGAGGACCTTTGCATTATCATGGAAAGCGTAGGATT
CGTTATCGAGAAATCACGCACCGGCATCCGTACCAAGTACGCACAGAACC
CGTCTTCAATGAAACAGAGCGAGTACCAGAGTCTTTTCTGGGTCTGCCGC
AAGCCGGATCTATTTGAGGAGCAGCGGGGCAAACGCAAGGCCTCCAGGGA
GCCACACGATCTTATTGTGCGCGAGGACAGCGAGGAGGAGGGGGAGCAAC
AGCCGGAACGAAATGAAACGGAAGAAAAACAGCAACTGAAACCGCTGGCC
ACAGCCAACTGCGAGACTGAGATAAAGGAGCAGCCATCGTGATAGCCATT
GAACCAAACTCAACAACACATCCAAACACCACAATCAAGTCCAAGTGCAA
ACCCACCTACAGATGGCATCACGAACATCTTAATTACCACGTCACAGGCA
AGACAGGGAATCGACACTGCAGTGCTTCGATGTTATAGATTACACTTTAT
ACCTATTATTTACTCCTACACACTGTTATATATGCCAGTTTTAATTTTTC
AAAGGATGCAAATTTTAGGACAATTTCTCGCTCATTATGCTCATCATGCT
AACTTAAATGGGAAAAGCGTCCCAACTAGGTCAACCAAATATATCAAAAG
AAAATTTTTAAAAAAAAAAAAAAAAAAA

LD23570.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1823619..1824356 1022..1759 3690 100 Plus
chrX 22417052 chrX 1823300..1823557 764..1021 1290 100 Plus
chrX 22417052 chrX 1822179..1822426 205..452 1240 100 Plus
chrX 22417052 chrX 1821561..1821766 1..206 1030 100 Plus
chrX 22417052 chrX 1822844..1823016 450..622 865 100 Plus
chrX 22417052 chrX 1823090..1823230 623..763 705 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-RC 1371 CG11596-PC 1..1371 72..1442 6855 100 Plus
CG11596-RE 1206 CG11596-PE 1..1206 237..1442 6030 100 Plus
CG11596-RD 1206 CG11596-PD 1..1206 237..1442 6030 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-RC 1791 CG11596-RC 33..1791 1..1759 8795 100 Plus
CG11596-RE 1765 CG11596-RE 211..1765 205..1759 7775 100 Plus
CG11596-RB 1648 CG11596-RB 95..1648 206..1759 7770 100 Plus
CG11596-RE 1765 CG11596-RE 33..212 1..180 900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-PC 456 CG11596-PC 1..456 72..1439 2319 100 Plus
CG11596-PA 439 CG11596-PA 1..439 72..1439 2205 96.3 Plus
CG11596-PE 401 CG11596-PE 1..401 237..1439 2024 100 Plus
CG11596-PD 401 CG11596-PD 1..401 237..1439 2024 100 Plus
CG11596-PB 401 CG11596-PB 1..401 237..1439 2024 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1929773..1930515 1022..1764 3715 100 Plus
X 23542271 X 1929454..1929711 764..1021 1290 100 Plus
X 23542271 X 1928333..1928580 205..452 1240 100 Plus
X 23542271 X 1927715..1927920 1..206 1030 100 Plus
X 23542271 X 1928998..1929170 450..622 865 100 Plus
X 23542271 X 1929244..1929384 623..763 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1937871..1938613 1022..1764 3715 100 Plus
X 23527363 X 1937552..1937809 764..1021 1290 100 Plus
X 23527363 X 1936431..1936678 205..452 1240 100 Plus
X 23527363 X 1935813..1936018 1..206 1030 100 Plus
X 23527363 X 1937096..1937268 450..622 865 100 Plus
X 23527363 X 1937342..1937482 623..763 705 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:27:59 has no hits.

LD23570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:51:32 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1823619..1824356 1022..1759 100   Plus
chrX 1823300..1823557 764..1021 100 -> Plus
chrX 1823090..1823230 623..763 100 -> Plus
chrX 1822847..1823016 453..622 100 -> Plus
chrX 1822180..1822426 206..452 100 -> Plus
chrX 1821561..1821765 1..205 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-11-23 15:00:26 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 1..1371 72..1442 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:27 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 1..1371 72..1442 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:31:56 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 1..1371 72..1442 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:51:32 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 1..1371 72..1442 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-11-23 15:00:25 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 36..1794 1..1759 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:27 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 36..1794 1..1759 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:31:56 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 33..1791 1..1759 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:51:32 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 33..1791 1..1759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:51:32 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
X 1929773..1930510 1022..1759 100   Plus
X 1929454..1929711 764..1021 100 -> Plus
X 1929244..1929384 623..763 100 -> Plus
X 1929001..1929170 453..622 100 -> Plus
X 1928334..1928580 206..452 100 -> Plus
X 1927715..1927919 1..205 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:31:56 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1823806..1824543 1022..1759 100   Plus
arm_X 1823487..1823744 764..1021 100 -> Plus
arm_X 1823277..1823417 623..763 100 -> Plus
arm_X 1823034..1823203 453..622 100 -> Plus
arm_X 1822367..1822613 206..452 100 -> Plus
arm_X 1821748..1821952 1..205 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:38 Download gff for LD23570.complete
Subject Subject Range Query Range Percent Splice Strand
X 1937871..1938608 1022..1759 100   Plus
X 1937552..1937809 764..1021 100 -> Plus
X 1937342..1937482 623..763 100 -> Plus
X 1937099..1937268 453..622 100 -> Plus
X 1936432..1936678 206..452 100 -> Plus
X 1935813..1936017 1..205 100 -> Plus

LD23570.pep Sequence

Translation from 71 to 1441

> LD23570.pep
MSSMDCATFPMHPKMDEQLARTFVINEEEEEKHIQKVQNAFLYYGPYACQ
RLKRSMDYLNSLSGEDQIMLAKYRGHLECVRTCIDRNQAVIREILRGRVL
YPTDEATGDPSEFDEPPPNVRHGDMDQIDIPFDEADVEPLKILKAQSTLK
LIARDWSTEGALEREQSYKPIIDSIVAYFKHSDFELKDIKILVPGAGLGR
LTYELACLGYSCEGNEFSYFMLIASNFVLNLCDNENKYVLYPWVHQYVNN
LRREDQVAPVRFPDVCPLKNPPKGHFEIAAGDFLEVYKTPNAYNCVATCF
FIDCANNVIDFIRTIYKILVPGGIWVNLGPLLYHFSDVSGQNSIEPAFED
LCIIMESVGFVIEKSRTGIRTKYAQNPSSMKQSEYQSLFWVCRKPDLFEE
QRGKRKASREPHDLIVREDSEEEGEQQPERNETEEKQQLKPLATANCETE
IKEQPS*

LD23570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22187-PA 436 GF22187-PA 1..395 15..421 1870 85.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12893-PA 460 GG12893-PA 1..460 1..456 2204 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17892-PA 419 GH17892-PA 1..419 15..444 1493 67.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-PC 456 CG11596-PC 1..456 1..456 2431 100 Plus
CG11596-PA 439 CG11596-PA 1..439 1..456 2317 96.3 Plus
CG11596-PE 401 CG11596-PE 1..401 56..456 2136 100 Plus
CG11596-PD 401 CG11596-PD 1..401 56..456 2136 100 Plus
CG11596-PB 401 CG11596-PB 1..401 56..456 2136 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21682-PA 424 GI21682-PA 10..423 9..430 1548 69.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15251-PA 453 GL15251-PA 1..412 1..421 1788 78.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11089-PA 453 GA11089-PA 1..414 1..423 1789 78 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19182-PA 455 GM19182-PA 1..455 4..456 2344 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16577-PA 457 GD16577-PA 1..457 4..456 2313 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15861-PA 430 GJ15861-PA 10..430 9..433 1528 68.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25180-PA 443 GK25180-PA 1..411 1..426 1696 74.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16224-PA 458 GE16224-PA 1..458 1..456 2177 93 Plus

LD23570.hyp Sequence

Translation from 71 to 1441

> LD23570.hyp
MSSMDCATFPMHPKMDEQLARTFVINEEEEEKHIQKVQNAFLYYGPYACQ
RLKRSMDYLNSLSGEDQIMLAKYRGHLECVRTCIDRNQAVIREILRGRVL
YPTDEATGDPSEFDEPPPNVRHGDMDQIDIPFDEADVEPLKILKAQSTLK
LIARDWSTEGALEREQSYKPIIDSIVAYFKHSDFELKDIKILVPGAGLGR
LTYELACLGYSCEGNEFSYFMLIASNFVLNLCDNENKYVLYPWVHQYVNN
LRREDQVAPVRFPDVCPLKNPPKGHFEIAAGDFLEVYKTPNAYNCVATCF
FIDCANNVIDFIRTIYKILVPGGIWVNLGPLLYHFSDVSGQNSIEPAFED
LCIIMESVGFVIEKSRTGIRTKYAQNPSSMKQSEYQSLFWVCRKPDLFEE
QRGKRKASREPHDLIVREDSEEEGEQQPERNETEEKQQLKPLATANCETE
IKEQPS*

LD23570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-PC 456 CG11596-PC 1..456 1..456 2431 100 Plus
CG11596-PA 439 CG11596-PA 1..439 1..456 2317 96.3 Plus
CG11596-PE 401 CG11596-PE 1..401 56..456 2136 100 Plus
CG11596-PD 401 CG11596-PD 1..401 56..456 2136 100 Plus
CG11596-PB 401 CG11596-PB 1..401 56..456 2136 100 Plus