Clone LD24527 Report

Search the DGRC for LD24527

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:245
Well:27
Vector:pOT2
Associated Gene/TranscriptAda2b-RA
Protein status:LD24527.pep: gold
Preliminary Size:2200
Sequenced Size:2165

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9638 2001-01-01 Release 2 assignment
CG9638 2001-09-19 Blastp of sequenced clone
CG9638 2003-01-01 Sim4 clustering to Release 3
Ada2b 2008-04-29 Release 5.5 accounting
Ada2b 2008-08-15 Release 5.9 accounting
Ada2b 2008-12-18 5.12 accounting

Clone Sequence Records

LD24527.complete Sequence

2165 bp (2165 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058546

> LD24527.complete
TTGACTTCGCGTCTGGTCACATTACTGGCATAGGTTTTTTTCGCACAACT
CATAATTGTCGTGAAAATCCAGGTTTTGGCCCAAAATGACCACAATCGCG
GATTTATTCACAAAGTATAATTGCACAAATTGCCAGGATGATATTCAGGG
CATTCGAGTGCACTGCGCGGAGTGCGAAAACTTCGATTTGTGTCTGCAAT
GCTTTGCCGCAGGTGCGGAGATCGGCGCCCATCAAAACAACCACTCCTAC
CAGTTCATGGACACCGGCACTTCCATATTGAGTGTATTTCGTGGAAAGGG
GGCGTGGACGGCACGAGAGGAAATCCGCCTGTTGGATGCAATCGAGCAGT
ACGGCTTTGGAAACTGGGAGGACATTAGCAAGCACATTGAGACGAAGTCA
GCGGAGGATGCCAAAGAGGAGTACGTGAATAAGTTTGTAAATGGCACGAT
TGGAAGGGCCACTTGGACGCCGGCCCAGAGCCAGAGACCCCGCCTTATCG
ATCACACTGGAGACGACGACGCTGGTCCTCTGGGCACCAATGCTCTCTCT
ACCTTGCCTCCACTGGAAATCAACTCCGATGAGGCCATGCAGCTGGGCTA
CATGCCCAACAGGGACAGCTTTGAGCGGGAGTACGATCCCACGGCAGAGC
AACTGATCTCGAACATCTCATTAAGCTCCGAGGATACGGAGGTGGATGTG
ATGCTTAAGCTGGCCCACGTTGACATATACACCCGCCGACTCAGAGAGCG
TGCTCGCAGGAAACGGATGGTCAGGGACTATCAATTAGTATCAAATTTCT
TCCGAAACAGAAATTACGCTCAGCAACAAGGACTCACCAAGGAGCAGCGC
GAGTTTCGGGACAGATTTCGGGTCTACGCCCAGTTCTACACGTGTAACGA
GTATGAGCGGCTATTGGGATCACTGGAGCGCGAAAAGGAACTGCGCATTC
GACAGTCAGAGCTGTACCGATACCGGTATAATGGCCTGACCAAAATCGCG
GAATGCACACATTTCGAGCAGCACGCCGCAACAGCGACGCACCGCTCTAC
AGGACCATATGGCCATGGCAAGACCCTCCACTGCATAATAAACGCGCCAA
ACAACGAGCGTTCGAATGGTTCTATAAGACAATGTTTAACCACAGGACCA
CACGCATACCTCCAATGGAAGTCATCGGCCGCCAAGCTCTTCCTTGCACT
CCCCACAACCGAATCTCAGAAAGGTCGAAATGTCAAGCGGCGGCGAGGCA
AGTTCAAATTCAATCGCACCAAGAAACACGCTCCACATCGCCGACCCGAC
CTGCTCCGGCGCATTATTGCCCAGCAAAAACTACTTGGATAGCTGTCGGG
GATCGTCGGCAGCTACGATGCTGCAGACGACGGGAATGGTAATGGGGGTA
ACAGTGGACTCGGGAGCGACGACGGGAGTGACTTCCACGGCTACGACGAT
GGCGAATCTGCCAACGAACTCGGCGAAGGGAAGCCAACAACATCTGCAGC
CGCTGCAGCAGCATCCTCAGCTCCTGCAAAGCGGCAACCAGCACAAAATG
CAAAACGAGGCCGCCGGCGGAGGCAGTGATCAGGTGCCCAGCATGAGCCT
GAAATTGCGCACCCAGCTGGAGGAACTAAAACATCTGCCACAGCCGCCGG
GCAGTGAACTGCTCAGTCACAACGAGCTGGATCTGTGCAAGAAGCATAAT
ATTACGCCCACCACCTACCTCTCGGTTAAGACTGTCTGCTTGAGCGGAGC
ACCATCGTTGGGTAGTCCTATGGAGACTTCGCTGCGCAAGTTCTTTATCA
AGTGCGGCTGGCTGAGCCACTGAACATCTTCCAACTTCCCGCTCCCCTTC
GATTAAGAGCCACATGCATTTCCAAGGACTTCACTTTATTTTTGTATTAG
TTAGAATAGGTTAAAGACATTTTTATACTGTTCAACTGTCGTTGGCATTT
TCATCAAGGTAAAAACTACAAAACTGAAAATCAATTTACTTGTATCAAGT
CAAGCTCAATTACAATAAGTGTTGTTCCTTTGTGTGAGATGTCGGGATTC
AGATATTGTGTATTAACTAAGCTTAAGTAGGGGACCCAACCAATTGAATA
TGTATGATATGAATTGTAAATGAAGTAATAAATGTAATAGTGAATGTAAA
AAAAAAAAAAAAAAA

LD24527.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RA 2275 Ada2b-RA 92..2239 1..2148 10740 100 Plus
Ada2b-RB 2194 Ada2b-RB 92..1166 1..1075 5375 100 Plus
Ada2b-RB 2194 Ada2b-RB 1167..2169 1146..2148 5015 100 Plus
DNApol-iota-RA 3189 DNApol-iota-RA 2910..3189 2148..1869 1400 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4063125..4064046 2147..1226 4595 99.9 Minus
chr3R 27901430 chr3R 4064742..4065621 1075..196 4385 99.9 Minus
chr3R 27901430 chr3R 4066321..4066519 199..1 995 100 Minus
chr3R 27901430 chr3R 4064114..4064263 1225..1076 750 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 1257 CG9638-PC 1..1257 86..1342 6285 100 Plus
Ada2b-RA 1257 CG9638-PA 1..1257 86..1342 6285 100 Plus
Ada2b-RB 1668 CG9638-PB 1..990 86..1075 4950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 2636 CG9638-RC 8..2154 1..2147 10735 100 Plus
Ada2b-RA 2154 CG9638-RA 8..2154 1..2147 10735 100 Plus
Ada2b-RB 2084 CG9638-RB 8..1082 1..1075 5375 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-PC 418 CG9638-PC 1..418 86..1339 2139 100 Plus
Ada2b-PA 418 CG9638-PA 1..418 86..1339 2139 100 Plus
Ada2b-PB 555 CG9638-PB 1..341 86..1129 1681 96.6 Plus
Ada2b-PB 555 CG9638-PB 331..555 1146..1820 886 100 Plus
Ada2a-PG 527 CG43663-PG 81..254 122..661 193 27.8 Plus
Ada2a-PC 527 CG43663-PC 81..254 122..661 193 27.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8237113..8238035 2148..1226 4615 100 Minus
3R 32079331 3R 8238731..8239610 1075..196 4385 99.9 Minus
3R 32079331 3R 8240310..8240508 199..1 995 100 Minus
3R 32079331 3R 8238103..8238252 1225..1076 750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7977944..7978866 2148..1226 4615 100 Minus
3R 31820162 3R 7979562..7980441 1075..196 4385 99.8 Minus
3R 31820162 3R 7981141..7981339 199..1 995 100 Minus
3R 31820162 3R 7978934..7979083 1225..1076 750 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:27:10 has no hits.

LD24527.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:34:49 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4066321..4066519 1..199 100   Minus
chr3R 4064742..4065617 200..1075 100 <- Minus
chr3R 4064114..4064263 1076..1225 100 <- Minus
chr3R 4063125..4064046 1226..2147 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:43 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 86..1342 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:20 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 86..1342 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:32 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 86..1342 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:33:53 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 86..1342 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:34:49 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 86..1342 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:51:56 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 5..2149 1..2145 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:20 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 5..2149 1..2145 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:32 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 8..2154 1..2147 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:33:53 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 5..2149 1..2145 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:34:49 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 8..2154 1..2147 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:34:49 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8240310..8240508 1..199 100   Minus
3R 8238731..8239606 200..1075 100 <- Minus
3R 8238103..8238252 1076..1225 100 <- Minus
3R 8237114..8238035 1226..2147 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:32 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4066032..4066230 1..199 100   Minus
arm_3R 4064453..4065328 200..1075 100 <- Minus
arm_3R 4063825..4063974 1076..1225 100 <- Minus
arm_3R 4062836..4063757 1226..2147 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:10:45 Download gff for LD24527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7981141..7981339 1..199 100   Minus
3R 7979562..7980437 200..1075 100 <- Minus
3R 7978934..7979083 1076..1225 100 <- Minus
3R 7977945..7978866 1226..2147 100 <- Minus

LD24527.pep Sequence

Translation from 85 to 1341

> LD24527.pep
MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQ
NNHSYQFMDTGTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKH
IETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQRPRLIDHTGDDDAGPLG
TNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSED
TEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFRNRNYAQQQGL
TKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG
LTKIAECTHFEQHAATATHRSTGPYGHGKTLHCIINAPNNERSNGSIRQC
LTTGPHAYLQWKSSAAKLFLALPTTESQKGRNVKRRRGKFKFNRTKKHAP
HRRPDLLRRIIAQQKLLG*

LD24527.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16168-PA 563 GF16168-PA 1..341 1..348 1689 92.2 Plus
Dana\GF23150-PA 624 GF23150-PA 81..374 13..301 168 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17470-PA 418 GG17470-PA 1..418 1..418 2163 97.8 Plus
Dere\GG16585-PA 527 GG16585-PA 81..375 13..301 245 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19246-PA 601 GH19246-PA 1..340 1..348 1567 85.1 Plus
Dgri\GH19029-PA 531 GH19029-PA 87..381 13..301 245 26.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-PC 418 CG9638-PC 1..418 1..418 2220 100 Plus
Ada2b-PA 418 CG9638-PA 1..418 1..418 2220 100 Plus
Ada2b-PB 555 CG9638-PB 1..341 1..348 1762 96.6 Plus
Ada2a-PG 527 CG43663-PG 81..379 13..305 245 26.3 Plus
Ada2a-PC 527 CG43663-PC 81..379 13..305 245 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24281-PA 417 GI24281-PA 1..417 1..418 1974 89.2 Plus
Dmoj\GI22841-PA 528 GI22841-PA 84..377 13..301 259 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23274-PA 420 GL23274-PA 1..177 154..330 830 92.1 Plus
Dper\GL22027-PA 629 GL22027-PA 86..384 12..305 187 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21933-PB 418 GA21933-PB 1..418 1..418 2084 94 Plus
Dpse\GA21933-PA 573 GA21933-PA 1..330 1..330 1664 94.2 Plus
Dpse\GA30250-PA 531 GA30250-PA 86..384 12..305 206 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26364-PA 555 GM26364-PA 1..341 1..348 1749 96.3 Plus
Dsec\GM15312-PA 527 GM15312-PA 81..375 13..301 235 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20886-PA 421 GD20886-PA 1..341 1..348 1736 96.3 Plus
Dsim\GD20190-PA 782 GD20190-PA 81..379 13..305 234 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23060-PA 579 GJ23060-PA 1..329 1..330 1586 90.3 Plus
Dvir\GJ24700-PA 527 GJ24700-PA 83..376 13..301 261 28.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14452-PA 561 GK14452-PA 1..332 1..332 1640 92.2 Plus
Dwil\GK22782-PA 529 GK22782-PA 83..380 13..305 261 27.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24869-PA 557 GE24869-PA 1..341 1..348 1741 95.7 Plus
Dyak\GE25222-PA 543 GE25222-PA 97..391 13..301 251 29 Plus

LD24527.hyp Sequence

Translation from 85 to 1341

> LD24527.hyp
MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQ
NNHSYQFMDTGTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKH
IETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQRPRLIDHTGDDDAGPLG
TNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSED
TEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFRNRNYAQQQGL
TKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG
LTKIAECTHFEQHAATATHRSTGPYGHGKTLHCIINAPNNERSNGSIRQC
LTTGPHAYLQWKSSAAKLFLALPTTESQKGRNVKRRRGKFKFNRTKKHAP
HRRPDLLRRIIAQQKLLG*

LD24527.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-PC 418 CG9638-PC 1..418 1..418 2220 100 Plus
Ada2b-PA 418 CG9638-PA 1..418 1..418 2220 100 Plus
Ada2b-PB 555 CG9638-PB 1..341 1..348 1762 96.6 Plus
Ada2a-PG 527 CG43663-PG 81..379 13..305 245 26.3 Plus
Ada2a-PC 527 CG43663-PC 81..379 13..305 245 26.3 Plus